pLS13 vector (V004938)

LOCUS       40924_28721        4460 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pLS13, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4460)
  AUTHORS   Hays LB, Chen Y-S.A., Hu JC.
  TITLE     A two-hybrid system for characterization of protein-protein 
            interactions in E. coli
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4460)
  AUTHORS   Hays LB, Chen Y-S.A., Hu JC.
  TITLE     Direct Submission
  JOURNAL   
REFERENCE   3  (bases 1 to 4460)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4460)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (14-JUL-1999) Biochemistry "
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4460
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      11..48
                     /label=operatorless mutant lacUV5 promoter
                     /note="operatorless mutant lacUV5 promoter"
                     /regulatory_class="promoter"
     CDS             73..657
                     /codon_start=1
                     /product="cI-GCN4IINI fusion protein"
                     /label=cI-GCN4IINI fusion protein
                     /note="cpntains N-terminal DNA binding domain from
                     bacteriophage lambda cI repressor, mutant GCN4 leucine 
                     zipper and linker for fusion to additional protein domains"
                     /protein_id="AAD50897.1"
                     /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ
                     SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY
                     PVFSHVQAGMFSPKLRTFTKGDAERWVSTHMKQLEDKIEELLSKIYHLENENARLKKLI
                     GERGGQLNASGSGAANKARKEAELAAATAEQ"
     terminator      658..705
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
     rep_origin      complement(1063..1607)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     promoter        1719..1747
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein
                     gene"
     CDS             1795..2982
                     /label=TcR
                     /note="tetracycline efflux protein"