pLHBA vector (V004997)

Basic Vector Information

Vector Name:
pLHBA
Antibiotic Resistance:
Streptomycin
Length:
7674 bp
Type:
Binary vector
Replication origin:
ori
Source/Author:
Hausmann L, Toepfer R.

pLHBA vector Map

pLHBA7674 bp3006009001200150018002100240027003000330036003900420045004800510054005700600063006600690072007500multiple cloning site from vector pBlueSfi BA in GenBank Accession Number AF327875compared to GenBank Accession Number X07435RB T-DNA repeatrepeat C'repeat Crepeat Brepeat Bcompared to GenBank Accession Number X074353' sequence of the ornithine cyclodeaminase gene ocd; non-functionaloricompared to GenBank Accession Number J01749bomregulatoryregulatoryregulatoryresolvasepalindromic sequenceregulatoryregulatoryregulatorypVS1 StaAidentical to the korB operator binding site of plasmid RK2 in GenBank Accession Number L27758.1pVS1 RepApalindromic sequencepVS1 oriVrepeat EregulatoryregulatorySmRpalindromic sequence; putative termination signalcompared to GenBank Accession Number X00493; removed to destroy a KpnI restriction siteLB T-DNA repeat

pLHBA vector Sequence

LOCUS       40924_28277        7674 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Binary vector pLHBA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7674)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Development of Plasmid Vectors
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7674)
  AUTHORS   Hausmann L, Toepfer R.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2003) Institute for Grapevine Breeding 
            Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE   3  (bases 1 to 7674)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7674)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-FEB-2003) Institute for Grapevine Breeding Geilweilerhof, 
            Siebeldingen 76833, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7674
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    2..103
                     /note="multiple cloning site from vector pBlueSfi BA in
                     GenBank Accession Number AF327875"
     regulatory      9..18
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     misc_difference 129
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    148..172
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     repeat_region   196..208
                     /label=repeat C'
                     /note="repeat C'"
     misc_difference 202
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     repeat_region   231..242
                     /label=repeat C
                     /note="repeat C"
     repeat_region   256..266
                     /label=repeat B
                     /note="repeat B"
     repeat_region   283..293
                     /label=repeat B
                     /note="repeat B"
     misc_difference 288
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 299
                     /replace="a"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(316..706)
                     /note="3' sequence of the ornithine cyclodeaminase gene
                     ocd; non-functional"
     misc_difference 492
                     /replace="t"
                     /label=compared to GenBank Accession Number X07435
                     /note="compared to GenBank Accession Number X07435"
                     /experiment="experimental evidence, no additional details
                     recorded"
     rep_origin      817..1405
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_difference 1503..1504
                     /replace="gta"
                     /label=compared to GenBank Accession Number J01749
                     /note="compared to GenBank Accession Number J01749"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_feature    complement(1590..1730)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     regulatory      2018..2023
                     /regulatory_class="minus_35_signal"
     regulatory      2044..2049
                     /regulatory_class="minus_10_signal"
     regulatory      2066..2070
                     /regulatory_class="ribosome_binding_site"
     CDS             2080..2766
                     /codon_start=1
                     /product="resolvase"
                     /label=resolvase
                     /note="resolvase-like protein encoded by parR of plasmid
                     pVS1; similar to Tn3 resolvase in GenBank Accession Number 
                     V00613, Tn917 resolvase in GenBank Accession Number M11180,
                     and RK2 ParA in GenBank Accession Number L27758"
                     /protein_id="AAO85341.1"
                     /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
                     RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
                     TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
                     DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
                     RQEEQA"
     misc_difference 2499
                     /replace="c"
                     /note="original nucleotide changed to destroy a SfiI
                     restriction site"
                     /experiment="experimental evidence, no additional details
                     recorded"
     stem_loop       2910..2942
                     /label=palindromic sequence
                     /note="palindromic sequence"
     misc_difference 2918
                     /replace="g"
                     /note="nucleotide changed to conserve palindromic sequence 
                     following SfiI restriction site-destruction"
                     /experiment="experimental evidence, no additional details
                     recorded"
     misc_difference 2933
                     /replace="c"
                     /note="original nucleotide changed to destroy two SfiI 
                     restriction sites"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      3000..3005
                     /regulatory_class="minus_35_signal"
     regulatory      3021..3026
                     /regulatory_class="minus_10_signal"
     regulatory      3054..3061
                     /regulatory_class="ribosome_binding_site"
     CDS             3065..3691
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     misc_feature    3961..3973
                     /note="identical to the korB operator binding site of
                     plasmid RK2 in GenBank Accession Number L27758.1"
     CDS             4123..5193
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     stem_loop       5210..5232
                     /label=palindromic sequence
                     /note="palindromic sequence"
     rep_origin      5262..5456
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     repeat_region   5553..5566
                     /label=repeat E
                     /rpt_unit_range=5553 .. 5559
                     /note="repeat E"
     regulatory      5797..5802
                     /regulatory_class="minus_35_signal"
     regulatory      5820..5825
                     /regulatory_class="minus_10_signal"
     CDS             6061..6849
                     /label=SmR
                     /note="aminoglycoside adenylyltransferase (Murphy, 1985)"
     stem_loop       6855..6912
                     /note="palindromic sequence; putative termination signal"
     misc_difference 7089..7090
                     /replace="ggtacc"
                     /note="compared to GenBank Accession Number X00493; removed
                     to destroy a KpnI restriction site"
     misc_feature    7372..7396
                     /label=LB T-DNA repeat
                     /note="left border repeat from octopine Ach5 T-DNA"

This page is informational only.