pLH9000 vector (Cat. No.: V005000)
Basic Information
- Name:
- pLH9000
- Antibiotic Resistance:
- Kanamycin
- Length:
- 9154 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Hausmann L, Toepfer R.
- Promoter:
- CaMV 35S
pLH9000 vector (Cat. No.: V005000) Sequence
LOCUS 40924_28262 9154 bp DNA circular SYN 18-DEC-2018
DEFINITION Binary vector pLH9000, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1482 to 1583)
AUTHORS Hausmann L, Toepfer R.
TITLE Development of Plasmid Vectors
JOURNAL (in) Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.); BIOENGINEERING
OF CUSTOM-TAILORED RAPE VARIETIES: 155-172; Gesellschaft fuer
Pflanzenzuechtung e. V., Von Sieboldstr. 8, Goettingen, Germany
(1999)
REFERENCE 2 (bases 1 to 9154)
AUTHORS Hausmann L, Toepfer R.
TITLE Direct Submission
JOURNAL Submitted (11-DEC-2001) Institute for Grapevine Breeding
Geilweilerhof, Siebeldingen 76833, Germany
REFERENCE 3 (bases 1 to 9154)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 9154)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "(in)
Brauer,D., Roebbelen,G. and Toepfer,R. (Eds.)"; volume: "
BIOENGINEERING OF CUSTOM-TAILORED RAPE VARIETIES"; pages: " 155-172;
Gesellschaft fuer Pflanzenzuechtung e. V., Von Sieboldstr. 8,
Goettingen, Germany (1999"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-DEC-2001) Institute for Grapevine Breeding Geilweilerhof,
Siebeldingen 76833, Germany"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..9154
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 80..424
/label=CaMV 35S promoter
/note="strong constitutive promoter from cauliflower mosaic
virus"
CDS 439..1239
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase from Tn5"
regulatory 1256..1455
/note="terminator sequence from the 35S gene of Cauliflower
mosaic virus; GenBank Accession Number: X05868, M31331"
/regulatory_class="terminator"
misc_difference 1289
/label=compared to GenBank Accession Number X05868
/note="compared to GenBank Accession Number X05868"
/experiment="experimental evidence, no additional details
recorded"
regulatory 1421..1436
/regulatory_class="polyA_signal_sequence"
misc_feature 1451
/label=putative transcription stop site
/note="putative transcription stop site"
misc_feature 1482..1583
/note="multiple cloning site from vector pBlueSfi BA;
GenBank Accession Number: AF327875"
/citation=[1]
regulatory 1489..1498
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
misc_difference 1609
/replace="a"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_feature 1628..1652
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
repeat_region 1676..1688
/label=repeat C'
/note="repeat C'"
misc_difference 1682
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
repeat_region 1711..1722
/label=repeat C
/note="repeat C"
repeat_region 1736..1746
/label=repeat B
/note="repeat B"
repeat_region 1763..1773
/label=repeat B
/note="repeat B"
misc_difference 1768
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_difference 1779
/replace="a"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
misc_feature 1796..2186
/note="3' sequence of the ornithine cyclodeaminase gene ocd
(non-functional)"
misc_difference 1972
/replace="t"
/label=compared to GenBank Accession Number X07435
/note="compared to GenBank Accession Number X07435"
/experiment="experimental evidence, no additional details
recorded"
rep_origin 2297..2885
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_difference 2983..2984
/replace="gta"
/label=compared to GenBank Accession Number J01749
/note="compared to GenBank Accession Number J01749"
/experiment="experimental evidence, no additional details
recorded"
misc_feature complement(3070..3210)
/label=bom
/note="basis of mobility region from pBR322"
regulatory 3498..3503
/regulatory_class="minus_35_signal"
regulatory 3524..3529
/regulatory_class="minus_10_signal"
regulatory 3546..3550
/regulatory_class="ribosome_binding_site"
CDS 3560..4246
/codon_start=1
/product="resolvase"
/label=resolvase
/note="resolvase-like protein encoded by parR of plasmid
pVS1; similar to Tn3 resolvase (GenBank Accession Number
V00613), Tn917 resolvase (GenBank Accession Number M11180)
and ParA (RK2) (GenBank Accession Number L27758)"
/protein_id="AAL78961.1"
/translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT
RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT
TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI
DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE
RQEEQA"
misc_difference 3979
/replace="c"
/note="original nucleotide changed to destroy a SfiI
restriction site"
/experiment="experimental evidence, no additional details
recorded"
stem_loop 4390..4422
/label=palindromic sequence
/note="palindromic sequence"
misc_difference 4398
/replace="g"
/note="nucleotide changed to conserve palindromic sequence
following SfiI restriction site-destruction"
/experiment="experimental evidence, no additional details
recorded"
misc_difference 4413
/replace="c"
/note="original nucleotide changed to destroy two SfiI
restriction sites"
/experiment="experimental evidence, no additional details
recorded"
regulatory 4480..4485
/regulatory_class="minus_35_signal"
regulatory 4501..4506
/regulatory_class="minus_10_signal"
regulatory 4534..4541
/regulatory_class="ribosome_binding_site"
CDS 4545..5171
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
misc_feature 5441..5453
/note="identical to the korB operator binding site of
plasmid RK2 (Pansegrau et al. 1994, J. Mol. Biol. 239:
623-663); GenBank Accession Number L27758"
CDS 5603..6673
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
stem_loop 6690..6712
/label=palindromic sequence
/note="palindromic sequence"
rep_origin 6742..6936
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
repeat_region 7033..7039
/label=repeat E
/note="repeat E"
repeat_region 7040..7046
/label=repeat E
/note="repeat E"
regulatory 7277..7282
/regulatory_class="minus_35_signal"
regulatory 7300..7305
/regulatory_class="minus_10_signal"
CDS 7541..8329
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
stem_loop 8335..8392
/note="palindromic sequence; putative termination signal"
misc_difference 8569..8570
/replace="ggtacc"
/note="compared to GenBank Accession Number X00493; removed
to destroy a KpnI restriction site"
misc_feature 8852..8876
/label=LB T-DNA repeat
/note="left border repeat from octopine Ach5 T-DNA"
This page is informational only.