Price Information
| Cat No. | Plasmid Name | Availability | Buy one, get one free! (?) |
|---|---|---|---|
| V005086 | pLac-GFP | In stock, instant shipping |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
The pLac-GFP construct constitutively expresses GFP and serves as a control throughout
- Vector Name:
- pLac-GFP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6465 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Swofford CA, Van Dessel N, Forbes NS.
- Promoter:
- lac
- Growth Strain(s):
- Top 10
- Growth Temperature:
- 37℃
pLac-GFP vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Swofford CA, Van Dessel N, Forbes NS. Quorum-sensing Salmonella selectively trigger protein expression within tumors. Proc Natl Acad Sci U S A. 2015 Mar 17;112(11):3457-62.
pLac-GFP vector Sequence
LOCUS V005086 6465 bp DNA circular SYN 31-AUG-2023
DEFINITION Exported.
ACCESSION V005086
VERSION V005086
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 6465)
AUTHORS Swofford CA, Van Dessel N, Forbes NS.
TITLE Quorum-sensing Salmonella selectively trigger protein expression
within tumors
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 112 (11), 3457-3462 (2015)
PUBMED 25737556
REFERENCE 2 (bases 1 to 6465)
AUTHORS Swofford CA, Van Dessel N, Forbes NS.
TITLE Direct Submission
JOURNAL Submitted (18-DEC-2014) Chemical Engineering, University of
Massachusetts Amherst, 686 North Pleasant Street, Amherst, MA
01003-9303, USA
REFERENCE 3 (bases 1 to 6465)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6465)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "2015"; volume: "112"; issue: "11"; pages:
"3457-3462"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(18-DEC-2014) Chemical Engineering, University of Massachusetts
Amherst, 686 North Pleasant Street, Amherst, MA 01003-9303, USA"
SGRef: number: 3; type: "Journal Article"
SGRef: number: 1; type: ""Journal Article""; journalName: ""Proc.
Natl. Acad. Sci. U.S.A.""; date: ""2015""; volume: ""112""; issue:
""11""; pages: ""3457-3462""
SGRef: number: 2; type: ""Journal Article""; journalName:
""Submitted (18-DEC-2014) Chemical Engineering, University of
Massachusetts Amherst, 686 North Pleasant Street, Amherst, MA
01003-9303, USA"" SGRef: number: 3; type: ""Journal Article""
FEATURES Location/Qualifiers
source 1..6465
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 133..154
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 169..199
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 207..223
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 231..247
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
CDS 275..988
/label="yeGFP"
/note="yeast-enhanced green fluorescent protein"
oriT 1615..1702
/label="RSF1010 oriT"
/note="origin of transfer of the broad-host-range plasmid
RSF1010 (Scholz et al., 1989)"
CDS 1783..3132
/codon_start=1
/label="DNA primase"
/translation="MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAESG
HMPEFVERPADYWDAADLYERANGRLFKEVEFALPVELTLDQQKALASEFAQHLTGAER
LPYTLAIHAGGGENPHCHLMISERINDGIERPAAQWFKRYNGKTPEKGGAQKTEALKPK
AWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGPNVVEMEGRGIRT
DRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEHGDTGR
RSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERPERVAGV
ALEAMANRDAGFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRTLQAIGRQ
LKAMGCERSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM"
rep_origin complement(3186..3774)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3948..4805)
/label="AmpR"
/note="beta-lactamase"
promoter complement(4806..4910)
/label="AmpR promoter"
CDS complement(5090..6193)
/gene="asd"
/label="Aspartate-semialdehyde dehydrogenase"
/note="Aspartate-semialdehyde dehydrogenase from Salmonella
typhimurium (strain LT2 / SGSC1412 / ATCC 700720).
Accession#: P0A1F8"