pLac-GFP vector (V005086)

Price Information

Cat No.	Plasmid Name	Availability	Add to cart
V005086	pLac-GFP	In stock (lyophilized plasmid)	Buy one, get one free!

Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.

Basic Vector Information

The pLac-GFP construct constitutively expresses GFP and serves as a control throughout

Vector Name:: pLac-GFP

Antibiotic Resistance:: Ampicillin

Length:: 6465 bp

Type:: Cloning vector

Replication origin:: ori

Source/Author:: Swofford CA, Van Dessel N, Forbes NS.

Promoter:: lac

Growth Strain(s):: Top 10

Growth Temperature:: 37℃

pLac-GFP vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

References

Swofford CA, Van Dessel N, Forbes NS. Quorum-sensing Salmonella selectively trigger protein expression within tumors. Proc Natl Acad Sci U S A. 2015 Mar 17;112(11):3457-62.

pLac-GFP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_27529        6465 bp DNA     circular SYN 31-AUG-2023
DEFINITION  Cloning vector pLac-GFP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6465)
  AUTHORS   Swofford CA, Van Dessel N, Forbes NS.
  TITLE     Quorum-sensing Salmonella selectively trigger protein expression 
            within tumors
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 112 (11), 3457-3462 (2015)
  PUBMED    25737556
REFERENCE   2  (bases 1 to 6465)
  AUTHORS   Swofford CA, Van Dessel N, Forbes NS.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-DEC-2014) Chemical Engineering, University of 
            Massachusetts Amherst, 686 North Pleasant Street, Amherst, MA 
            01003-9303, USA
REFERENCE   3  (bases 1 to 6465)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6465)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "2015"; volume: "112"; issue: "11"; pages:
            "3457-3462"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (18-DEC-2014) Chemical Engineering, University of Massachusetts 
            Amherst, 686 North Pleasant Street, Amherst, MA 01003-9303, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
            SGRef: number: 1; type: ""Journal Article""; journalName: ""Proc. 
            Natl. Acad. Sci. U.S.A.""; date: ""2015""; volume: ""112""; issue: 
            ""11""; pages: ""3457-3462""
            SGRef: number: 2; type: ""Journal Article""; journalName: 
            ""Submitted (18-DEC-2014) Chemical Engineering, University of 
            Massachusetts Amherst, 686 North Pleasant Street, Amherst, MA 
            01003-9303, USA"" SGRef: number: 3; type: ""Journal Article""
FEATURES             Location/Qualifiers
     source          1..6465
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    133..154
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        169..199
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    207..223
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     231..247
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             275..988
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     oriT            1615..1702
                     /label=RSF1010 oriT
                     /note="origin of transfer of the broad-host-range plasmid 
                     RSF1010 (Scholz et al., 1989)"
     CDS             1783..3132
                     /codon_start=1
                     /label=DNA primase
                     /translation="MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAESG
                     HMPEFVERPADYWDAADLYERANGRLFKEVEFALPVELTLDQQKALASEFAQHLTGAER
                     LPYTLAIHAGGGENPHCHLMISERINDGIERPAAQWFKRYNGKTPEKGGAQKTEALKPK
                     AWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGPNVVEMEGRGIRT
                     DRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEHGDTGR
                     RSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERPERVAGV
                     ALEAMANRDAGFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRTLQAIGRQ
                     LKAMGCERSSASSLTDSLRSVVRLRRAVSAHSKAVIRLSTESGDNAGKNM"
     rep_origin      complement(3186..3774)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(3948..4805)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(4806..4910)
                     /label=AmpR promoter
     CDS             complement(5090..6193)
                     /gene="asd"
                     /label=asd
                     /note="Aspartate-semialdehyde dehydrogenase from Salmonella
                     typhimurium (strain LT2 / SGSC1412 / ATCC 700720). 
                     Accession#: P0A1F8"