Basic Vector Information
- Vector Name:
- pMiniT
- Antibiotic Resistance:
- Ampicillin
- Length:
- 2525 bp
- Type:
- Cloning Vectors
- Replication origin:
- ori
- Source/Author:
- New England Biolabs
- Copy Number:
- High copy number
pMiniT vector Map
pMiniT vector Sequence
LOCUS pMiniT. 2525 bp DNA circular SYN 01-JAN-1980
DEFINITION Compact bacterial vector that employs a toxic minigene for
high-efficiency cloning of PCR products.
ACCESSION .
VERSION .
KEYWORDS pMiniT
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 2525)
AUTHORS New England Biolabs
TITLE Direct Submission
REFERENCE 2 (bases 1 to 2525)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..2525
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 145..251
/gene="tnpA"
/label=tnpA promoter
/note="tnpA promoter"
/note="promoter of the IS10 transposase"
CDS 252..482
/codon_start=1
/product="transposase encoded by the IS10 tnpA gene"
/label=transposase encoded by the IS10 tnpA gene
/note="tnpA transposase"
/translation="MCELDILHDSLYQFCPELHLKRLNSLTLACHALLDCKTLTLTELG
RNLPTKARTKHNIKRIDRLLGNRHLHKERLAV"
RBS 504..510
/label=Shine-Dalgarno sequence
/note="Shine-Dalgarno sequence"
/note="ribosome binding site"
CDS 518..523
/codon_start=1
/product="two-residue polypeptide that poisons the E. coli
translation machinery"
/label=two-residue polypeptide that poisons the E. col
/note="toxic minigene"
/translation="MI"
misc_feature 524..535
/label=stop codons
/note="stop codons"
promoter 565..669
/label=AmpR promoter
CDS 670..1527
/label=AmpR
/note="beta-lactamase"
rep_origin 1701..2289
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.