Basic Vector Information
- Vector Name:
- pTurboGFP-PRL
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4130 bp
- Type:
- Fluorescent Protein Genes & Plasmids
- Replication origin:
- ori
- Source/Author:
- Evrogen
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- SV40
pTurboGFP-PRL vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTurboGFP-PRL vector Sequence
LOCUS 40924_44459 4130 bp DNA circular SYN 01-JAN-1980 DEFINITION Promoterless TurboGFP reporter vector. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4130) AUTHORS Evrogen TITLE Direct Submission REFERENCE 2 (bases 1 to 4130) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" COMMENT Can be used to monitor transcription from a promoter inserted into the MCS. FEATURES Location/Qualifiers source 1..4130 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 9..89 /label=MCS /note="multiple cloning site" CDS 97..792 /codon_start=1 /label=TurboGFP /note="improved green fluorescent protein from Pontellina plumata (Evdokimov et al., 2006)" /translation="MESDESGLPAMEIECRITGTLNGVEFELVGGGEGTPEQGRMTNKM KSTKGALTFSPYLLSHVMGYGFYHFGTYPSGYENPFLHAINNGGYTNTRIEKYEDGGVL HVSFSYRYEAGRVIGDFKVMGTGFPEDSVIFTDKIIRSNATVEHLHPMGDNDLDGSFTR TFSLRDGGYYSSVVDSHMHFKSAIHPSILQNGGPMFAFRRVEEDHSNTELGIVEYQHAF KTPDADAGEE" polyA_signal 918..1039 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(1046..1501) /direction=LEFT /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" promoter 1528..1632 /label=AmpR promoter promoter 1634..1991 /label=SV40 promoter /note="SV40 enhancer and early promoter" CDS 2026..2817 /codon_start=1 /label=NeoR/KanR /note="aminoglycoside phosphotransferase" /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF" polyA_signal 3052..3099 /label=HSV TK poly(A) signal /note="herpes simplex virus thymidine kinase polyadenylation signal (Cole and Stacy, 1985)" rep_origin 3428..4016 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.