Basic Vector Information
- Vector Name:
- pOTB7a
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 1804 bp
- Type:
- I.M.A.G.E. Consortium Plasmids
- Replication origin:
- ori
- Source/Author:
- I.M.A.G.E. Consortium
- Copy Number:
- High copy number
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 fwd
pOTB7a vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOTB7a vector Sequence
LOCUS 40924_33957 1804 bp DNA circular SYN 01-JAN-1980 DEFINITION cDNA cloning vector derived from pOTB7. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 1804) AUTHORS I.M.A.G.E. Consortium TITLE Direct Submission REFERENCE 2 (bases 1 to 1804) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..1804 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 53..71 /label=SP6 promoter /note="promoter for bacteriophage SP6 RNA polymerase" protein_bind 85..109 /label=attB1 /note="recombination site for the Gateway(R) BP reaction" primer_bind 111..127 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind complement(243..266) /label=attB2 /note="recombination site for the Gateway(R) BP reaction" promoter complement(282..300) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" rep_origin 404..992 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS 1133..1789 /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.