pIZT/V5-His vector (V011613) Gene synthesis in pIZT/V5-His backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V011613 pIZT/V5-His In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

An insect cell expression vector featuring a constitutive promoter driving a ​GFP-Zeocin resistance fusion gene cassette. This system enables both selection (via Zeocin) and visual monitoring (via GFP) of stably transfected cells. It is designed for ​constitutive protein expression​ and ​optionally incorporates a C-terminal V5-6xHis tag​ for detection and purification.

Vector Name:
pIZT/V5-His
Antibiotic Resistance:
Zeocin
Length:
3336 bp
Type:
Insect Cell Vectors
Replication origin:
ori
Source/Author:
Invitrogen (Life Technologies)
Copy Number:
High copy number
Promoter:
OpIE-2
Growth Strain(s):
DH10B
Growth Temperature:
37℃

pIZT/V5-His vector Map

pIZT/V5-His3336 bp6001200180024003000OpIE-2 promoterMCSV5 tag6xHisOpIE-2 poly(A) signaloriOpIE-1 promoterEM7 promoterATGCycle 3 GFPSV40 poly(A) signal

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Liang Z, Lu Y, Qian Y, Zhu L, Kuang S, Chen F, Feng Y, Hu X, Cao G, Xue R, Gong C. Cultured cells and wing disc size of silkworm can be controlled by the Hippo pathway. Open Biol. 2018 Jul;8(7):180029. doi: 10.1098/rsob.180029. PMID: 29973396; PMCID: PMC6070717.

pIZT/V5-His vector Sequence

LOCUS       pIZT_V5-His.        3336 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Insect cell vector with a GFP-Zeocin(TM) resistance fusion gene, for
            constitutive expression of proteins with an optional C-terminal 
            V5-6xHis tag.
ACCESSION   .
VERSION     .
KEYWORDS    pIZT V5-His
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3336)
  AUTHORS   Invitrogen (Life Technologies)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 3336)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3336
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        5..552
                     /label=OpIE-2 promoter
                     /note="strong constitutive baculovirus promoter for insect
                     cell expression"
     misc_feature    567..656
                     /label=MCS
                     /note="MCS"
                     /note="multiple cloning site"
     CDS             663..704
                     /label=V5 tag
                     /note="epitope tag from simian virus 5"
     CDS             714..731
                     /label=6xHis
                     /note="6xHis affinity tag"
     polyA_signal    749..878
                     /label=OpIE-2 poly(A) signal
                     /note="baculovirus polyadenylation signal"
     rep_origin      complement(1006..1594)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        1669..1960
                     /label=OpIE-1 promoter
                     /note="moderate constitutive baculovirus promoter for
                     insect cell expression"
     promoter        1986..2033
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             2052..2054
                     /codon_start=1
                     /product="start codon"
                     /label=start codon
                     /note="ATG"
                     /translation="M"
     CDS             2067..2771
                     /label=Cycle 3 GFP
                     /note="Cycle 3 GFP (Crameri et al., 1996)"
     CDS             2766..3143
                     /codon_start=1
                     /gene="Sh ble from Streptoalloteichus hindustanus"
                     /product="antibiotic-binding protein"
                     /label=Sh ble from Streptoalloteichus hindustanus
                     /note="BleoR"
                     /note="confers resistance to bleomycin, phleomycin, and 
                     Zeocin(TM)"
                     /translation="MDAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRD
                     DVTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWG
                     REFALRDPAGNCVHFVAEEQD"
     polyA_signal    3207..3336
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"