pMetLuc-Mem Reporter vector (V011465)

LOCUS       pMetLuc-Mem_Repo        4351 bp DNA     circular SYN 01-JAN-1980
DEFINITION  In vivo imaging vector for measuring promoter activity with 
            membrane-anchored Metridia luciferase.
ACCESSION   .
VERSION     .
KEYWORDS    pMetLuc-Mem Reporter
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4351)
  AUTHORS   Clontech
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 4351)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4351
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    9..89
                     /label=MCS
                     /note="multiple cloning site"
     CDS             97..99
                     /codon_start=1
                     /product="start codon"
                     /label=start codon
                     /note="ATG"
                     /translation="M"
     CDS             103..288
                     /codon_start=1
                     /product="signal-anchor region of the transferrin receptor"
                     /label=signal-anchor region of the transferrin receptor
                     /note="TfR membrane anchor"
                     /translation="VDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGTIAV
                     IVFFLIGFMIGYLGYCK"
     CDS             322..927
                     /codon_start=1
                     /product="Metridia luciferase"
                     /label=Metridia luciferase
                     /note="MetLuc"
                     /note="human codon-optimized"
                     /translation="KSTEFDPNIDIVGLEGKFGITNLETDLFTIWETMEVMIKADIADT
                     DRASNFVATETDANRGKMPGKKLPLAVIMEMEANAFKAGCTRGCLICLSKIKCTAKMKV
                     YIPGRCHDYGGDKKTGQAGIVGAIVDIPEISGFKEMAPMEQFIAQVDRCASCTTGCLKG
                     LANVKCSELLKKWLPDRCASFADKIQKEVHNIKGMAGDR"
     polyA_signal    1051..1172
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1179..1634)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        1661..1765
                     /label=AmpR promoter
     promoter        1834..2044
                     /label=SV40 promoter
                     /note="SV40 early promoter"
     CDS             2087..2878
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     polyA_signal    3113..3160
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      3489..4077
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     polyA_signal    4139..4187
                     /label=poly(A) signal
                     /note="synthetic polyadenylation signal"
     misc_feature    4201..4292
                     /label=pause site
                     /note="RNA polymerase II transcriptional pause signal from
                     the human alpha-2 globin gene"