pNFκB-MetLuc2-Reporter vector (V011460)

MSDS

Basic Vector Information

Vector Name:: pNFκB-MetLuc2-Reporter

Antibiotic Resistance:: Kanamycin

Length:: 4366 bp

Type:: Luciferase Vectors

Replication origin:: ori

Source/Author:: Clontech

Selection Marker:: Neomycin/G418(Geneticin)

Copy Number:: High copy number

Promoter:: SV40

pNFκB-MetLuc2-Reporter vector Vector Map

View Map in NovoBuilder

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pNFκB-MetLuc2-Reporter vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_33128        4366 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Vector for monitoring NF-kappa-B-mediated signal transduction using 
            secreted Metridia luciferase.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4366)
  AUTHORS   Clontech
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 4366)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4366
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     protein_bind    46..85
                     /label=NFkB enhancer element
                     /bound_moiety="NF-kappa-B"
                     /note="NF-kappa-B RE"
                     /note="NF-kappa-B response element (4 copies)"
     promoter        98..129
                     /label=minP
                     /note="minimal TATA-box promoter with low basal activity"
     CDS             213..869
                     /codon_start=1
                     /label=MetLuc
                     /note="secreted Metridia luciferase"
                     /translation="MDIKVVFTLVFSALVQAKSTEFDPNIDIVGLEGKFGITNLETDLF
                     TIWETMEVMIKADIADTDRASNFVATETDANRGKMPGKKLPLAVIMEMEANAFKAGCTR
                     GCLICLSKIKCTAKMKVYIPGRCHDYGGDKKTGQAGIVGAIVDIPEISGFKEMAPMEQF
                     IAQVDRCASCTTGCLKGLANVKCSELLKKWLPDRCASFADKIQKEVHNIKGMAGDR"
     polyA_signal    994..1115
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1122..1577)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        1604..1708
                     /label=AmpR promoter
     promoter        1710..2067
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     CDS             2102..2893
                     /codon_start=1
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    3128..3175
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      3504..4092
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     polyA_signal    4154..4202
                     /label=poly(A) signal
                     /note="synthetic polyadenylation signal"
     misc_feature    4216..4307
                     /label=pause site
                     /note="RNA polymerase II transcriptional pause signal from
                     the human alpha-2 globin gene"

This page is informational only.