pSELECT-zeo-Lucia vector (Cat. No.: V011443)
- Name:
- pSELECT-zeo-Lucia
- Antibiotic Resistance:
- Zeocin
- Length:
- 3769 bp
- Type:
- Luciferase Vectors
- Replication origin:
- ori
- Source/Author:
- InvivoGen
- Copy Number:
- High copy number
- Promoter:
- EF-1α core
- Growth Strain(s):
- Top10
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pSELECT-zeo-Lucia vector (Cat. No.: V011443) Sequence
LOCUS pSELECT-zeo-Luci 3769 bp DNA circular SYN 01-JAN-1980
DEFINITION Mammalian vector for the expression of secreted Lucia(R) luciferase.
ACCESSION .
VERSION .
KEYWORDS pSELECT-zeo-Lucia
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3769)
AUTHORS InvivoGen
TITLE Direct Submission
REFERENCE 2 (bases 1 to 3769)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3769
/mol_type="other DNA"
/organism="synthetic DNA construct"
polyA_signal 9..57
/label=poly(A) signal
/note="synthetic polyadenylation signal"
misc_feature 68..159
/label=pause site
/note="RNA polymerase II transcriptional pause signal from
the human alpha-2 globin gene"
promoter 196..407
/label=EF-1-alpha core promoter
/note="core promoter for human elongation factor
EF-1-alpha"
LTR 420..688
/label=5' LTR (truncated)
/note="truncated 5' long terminal repeat (LTR) from human
T-cell leukemia virus (HTLV) type 1"
CDS 728..1357
/codon_start=1
/product="secreted coelenterazine-utilizing luciferase"
/label=secreted coelenterazine-utilizing luciferase
/note="Lucia(R)"
/note="synthetic gene based on luciferases from marine
copepods"
/translation="MEIKVLFALICIAVAEAKPTEINEDLNIAAVASNFATTDLETDLF
TNWETMNVISTDTEQVNTDADRGKLPGKKLPPDVLRELEANARRAGCTRGCLICLSHIK
CTPKMKKFIPGRCHTYEGEKESAQGGIGEAIVDIPEIPGFKDKEPLDQFIAQVDLCADC
TTGCLKGLANVQCSDLLKKWLPQRCTTFASKIQGRVDKIKGLAGDR"
polyA_signal complement(1379..1500)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
polyA_signal complement(1600..1994)
/label=beta-globin poly(A)
/note="human beta-globin polyadenylation signal"
CDS complement(2011..2382)
/label=BleoR
/note="antibiotic-binding protein"
promoter complement(2402..2449)
/label=EM7 promoter
/note="synthetic bacterial promoter"
promoter complement(2495..2698)
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
enhancer complement(2699..3002)
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
rep_origin complement(3082..3670)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"