pBK-CMV vector (Cat. No.: V011347)

pBK-CMV4518 bp600120018002400300036004200f1 oriSV40 poly(A) signalM13 fwdT7 promotermultiple cloning siteT3 promoterM13 revlac operatorCMV promoterCMV enhanceroriHSV TK poly(A) signalNeoR/KanRSV40 promoterAmpR promoter
Basic Information

Note: pBK-CMV is a mammalian expression vector. It uses the strong cytomegalovirus (CMV) promoter to drive high-level expression of cloned genes in mammalian cells and contains a neomycin resistance gene for selection. Its backbone is derived from pBluescript II.

Name:
pBK-CMV
Antibiotic Resistance:
Kanamycin
Length:
4518 bp
Type:
Mammalian Expression Vectors
Replication origin:
ori
Source/Author:
Agilent Technologies
Selection Marker:
Neomycin/G418(Geneticin)
Copy Number:
High copy number
Promoter:
CMV
5' Primer:
M13 fwd
3' Primer:
M13 rev
Growth Temperature:
37℃
$ 198.7
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Machuca J, Ortiz M, Recacha E, Díaz-De-Alba P, Docobo-Perez F, Rodríguez-Martínez JM, Pascual Á. Impact of AAC(6')-Ib-cr in combination with chromosomal-mediated mechanisms on clinical quinolone resistance in Escherichia coli. J Antimicrob Chemother. 2016 Nov;71(11):3066-3071. doi: 10.1093/jac/dkw258. Epub 2016 Jul 11. PMID: 27494906.

pBK-CMV vector (Cat. No.: V011347) Sequence

LOCUS       Exported                4518 bp DNA     circular SYN 01-APR-2026
DEFINITION  Phagemid vector pBK-CMV, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4518)
  AUTHORS   Marsh S.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-OCT-1995) Marketing Analysis, Stratagene, 11011 North 
            Torrey Pines Road, La Jolla, CA 92037, USA
REFERENCE   2  (bases 1 to 4518)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 4518)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4518)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 4518)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
            (04-OCT-1995) Marketing Analysis, Stratagene, 11011 North Torrey
            Pines Road, La Jolla, CA 92037, USA"
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4518
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      7..462
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     polyA_signal    complement(469..590)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     primer_bind     952..968
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        975..993
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    1015..1122
                     /label=multiple cloning site
                     /note="multiple cloning site"
     promoter        complement(1140..1158)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(1179..1195)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(1203..1219)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1328..1531)
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     enhancer        complement(1532..1835)
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     rep_origin      complement(2010..2598)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     polyA_signal    complement(2927..2974)
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     CDS             complement(3209..4000)
                     /codon_start=1
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     promoter        complement(4035..4392)
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     promoter        complement(4394..4498)
                     /label=AmpR promoter