pBK-CMV vector (Cat. No.: V011347)
Note: pBK-CMV is a mammalian expression vector. It uses the strong cytomegalovirus (CMV) promoter to drive high-level expression of cloned genes in mammalian cells and contains a neomycin resistance gene for selection. Its backbone is derived from pBluescript II.
- Name:
- pBK-CMV
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4518 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Agilent Technologies
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CMV
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Machuca J, Ortiz M, Recacha E, Díaz-De-Alba P, Docobo-Perez F, Rodríguez-Martínez JM, Pascual Á. Impact of AAC(6')-Ib-cr in combination with chromosomal-mediated mechanisms on clinical quinolone resistance in Escherichia coli. J Antimicrob Chemother. 2016 Nov;71(11):3066-3071. doi: 10.1093/jac/dkw258. Epub 2016 Jul 11. PMID: 27494906.
pBK-CMV vector (Cat. No.: V011347) Sequence
LOCUS Exported 4518 bp DNA circular SYN 01-APR-2026
DEFINITION Phagemid vector pBK-CMV, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4518)
AUTHORS Marsh S.
TITLE Direct Submission
JOURNAL Submitted (04-OCT-1995) Marketing Analysis, Stratagene, 11011 North
Torrey Pines Road, La Jolla, CA 92037, USA
REFERENCE 2 (bases 1 to 4518)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 4518)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4518)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 4518)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted
(04-OCT-1995) Marketing Analysis, Stratagene, 11011 North Torrey
Pines Road, La Jolla, CA 92037, USA"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4518
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin 7..462
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
polyA_signal complement(469..590)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
primer_bind 952..968
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 975..993
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
misc_feature 1015..1122
/label=multiple cloning site
/note="multiple cloning site"
promoter complement(1140..1158)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(1179..1195)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1203..1219)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1328..1531)
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
enhancer complement(1532..1835)
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
rep_origin complement(2010..2598)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
polyA_signal complement(2927..2974)
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
CDS complement(3209..4000)
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
promoter complement(4035..4392)
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
promoter complement(4394..4498)
/label=AmpR promoter