pCMV-Script vector (Cat. No.: V011243)
Note: pCMV - Script is a mammalian expression plasmid from a high - copy pUC - based one. It has a human CMV immediate - early promoter for high - level target gene expression in many mammalian cell lines. Its PCR cloning system can finish cloning in an hour without adding extra primer bases, efficiently yielding PCR fragments with low false - positive rates.
- Name:
- pCMV-Script
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4278 bp
- Type:
- Mammalian Expression Vectors
- Replication origin:
- ori
- Source/Author:
- Agilent Technologies
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Growth Strain(s):
- Top10
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pCMV-Script vector (Cat. No.: V011243) Sequence
LOCUS 40924_11755 4278 bp DNA circular SYN 17-DEC-2018
DEFINITION Mammalian expression vector pCMV-Script, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4278)
AUTHORS Hosfield T, Padgett K, Sanchez T, Lu Q.
TITLE Mammalian expression vector for efficient cloning of PCR fragments
JOURNAL Strategies 10, 68-69 (1997)
REFERENCE 2 (bases 1 to 4278)
AUTHORS Hosfield T, Padgett K, Sanchez T, Lu Q.
TITLE Direct Submission
JOURNAL Submitted (02-OCT-1997) Marketing Analysis, Stratagene, 11011 North
Torrey Pines Rd, La Jolla, CA 92037, USA
REFERENCE 3 (bases 1 to 4278)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4278)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Strategies
10, 68-69 (1997)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-OCT-1997) Marketing Analysis, Stratagene, 11011 North Torrey
Pines Rd, La Jolla, CA 92037, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4278
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 67..370
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 371..574
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 620..638
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
misc_feature 651..758
/label=MCS
/note="pBluescript multiple cloning site"
promoter complement(780..798)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
polyA_signal 1072..1193
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(1200..1655)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 1682..1784
/label=AmpR promoter
promoter 1788..2145
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 2180..2971
/codon_start=1
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
polyA_signal 3206..3253
/label=HSV TK poly(A) signal
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
rep_origin 3582..4170
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"