pHet-Act1-2 vector (V011116)

LOCUS       pHet-Act1-2.        8202 bp DNA     circular SYN 01-JAN-1980
DEFINITION  Mammalian vector encoding a transcription factor activation domain 
            and a DNA-binding domain that can be assembled by drug-induced 
            heterodimerization.
ACCESSION   .
VERSION     .
KEYWORDS    pHet-Act1-2
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8202)
  AUTHORS   Clontech
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 8202)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8202
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        139..517
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        518..729
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     intron          890..1022
                     /label=chimeric intron
                     /note="chimera between introns from human beta-globin and 
                     immunoglobulin heavy chain genes"
     promoter        1067..1085
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     CDS             1102..1104
                     /codon_start=1
                     /product="start codon"
                     /label=start codon
                     /note="ATG"
                     /translation="M"
     CDS             1114..1392
                     /label=FRB
                     /note="FKBP-rapamycin binding domain of human FRAP"
     CDS             1600..1971
                     /label=RelA (p65) AD
                     /note="transcriptional activation domain of human RelA,
                     also known as p65 (O'Shea and Perkins, 2008)"
     misc_feature    2040..2626
                     /label=IRES2
                     /note="internal ribosome entry site (IRES) of the 
                     encephalomyocarditis virus (EMCV)"
     CDS             2647..2649
                     /codon_start=1
                     /product="start codon"
                     /label=start codon
                     /note="ATG"
                     /translation="M"
     CDS             2656..2682
                     /label=c-myc NLS
                     /note="nuclear localization signal of human c-Myc
                     proto-oncogene (Dang and Lee, 1988)"
     CDS             2689..3051
                     /label=ZFHD1 (DNA binding domain)
                     /note="composite human DNA-binding domain composed of
                     domains from the transcription factors Zif268 and Oct-1 
                     (Pomerantz et al., 1995)"
     CDS             3058..3378
                     /label=FKBP
                     /note="human FK506-binding protein FKBP12"
     CDS             3388..3705
                     /codon_start=1
                     /product="human FK506-binding protein FKBP12"
                     /note="FKBP (DmrA)"
                     /translation="VQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPF
                     KFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLK
                     LE"
     CDS             3712..4032
                     /codon_start=1
                     /product="human FK506-binding protein FKBP12"
                     /note="FKBP (DmrA)"
                     /translation="GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKP
                     FKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELL
                     KLE"
     polyA_signal    complement(4101..4222)
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      4408..4863
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        4980..5337
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     CDS             5388..5984
                     /label=PuroR
                     /note="puromycin N-acetyltransferase"
     polyA_signal    6051..6099
                     /label=poly(A) signal
                     /note="synthetic polyadenylation signal"
     promoter        6405..6509
                     /label=AmpR promoter
     CDS             6510..7367
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      7541..8129
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"