pCAMBIA2300 vector (Cat. No.: V010873)
Note: pCAMBIA2300 is a binary vector for plant transformation. It contains T-DNA borders for Agrobacterium-mediated transfer, a kanamycin resistance gene for bacterial selection, and a GUS reporter gene for visualizing transformation success in plant tissues.
- Name:
- pCAMBIA2300
- Antibiotic Resistance:
- Kanamycin
- Length:
- 8744 bp
- Type:
- Plant Vectors
- Replication origin:
- ori
- Host:
- Plants
- Source/Author:
- Cambia
- Selection Marker:
- Neomycin/G418(Geneticin)
- Copy Number:
- High copy number
- Promoter:
- CaMV 35S (enhanced)
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
- Growth Strain(s):
- stbl3
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
References
- Sahab S, Taylor N. Studies on Pure Mlb® (Multiple Left Border) Technology and Its Impact on Vector Backbone Integration in Transgenic Cassava. Front Plant Sci. 2022 Feb 4;13:816323. doi: 10.3389/fpls.2022.816323. PMID: 35185986; PMCID: PMC8855067.
- Leclercq J, Szabolcs T, Martin F, Montoro P. Development of a new pCAMBIA binary vector using Gateway® technology. Plasmid. 2015 Sep;81:50-4. doi: 10.1016/j.plasmid.2015.07.003. Epub 2015 Jul 23. PMID: 26210260.
- Matheka J, Tripathi JN, Merga I, Gebre E, Tripathi L. A simple and rapid protocol for the genetic transformation of Ensete ventricosum. Plant Methods. 2019 Nov 8;15:130. doi: 10.1186/s13007-019-0512-y. PMID: 31719836; PMCID: PMC6839154.
pCAMBIA2300 vector (Cat. No.: V010873) Sequence
LOCUS Exported 8744 bp DNA circular SYN 10-SEP-2025
DEFINITION Agrobacterium binary vector for plant transformation, with
kanamycin-resistance genes.
ACCESSION AF234315
VERSION .
KEYWORDS pCAMBIA2300
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8744)
AUTHORS Cambia
TITLE Direct Submission
REFERENCE 2 (bases 1 to 8744)
TITLE Direct Submission
REFERENCE 3 (bases 1 to 8744)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"
COMMENT SGRef: number: 2; type: "Journal Article"
COMMENT The GenBank record was corrected by inserting a G at position 2281.
FEATURES Location/Qualifiers
source 1..8744
/lab_host="Plant Cells"
/mol_type="other DNA"
/organism="synthetic DNA construct"
source join(641..8744,1..640)
/lab_host="Plant Cells"
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 167..197
/note="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind 205..221
/label=lac repressor encoded by lacI binding site
/bound_moiety="lac repressor encoded by lacI"
/note="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 229..245
/label=M13 rev
/note="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
CDS 241..474
/codon_start=1
/gene="lacZ (truncated)"
/product="LacZ-alpha fragment of beta-galactosidase"
/label=lacZ (truncated)
/note="lacZ-alpha"
/translation="MTMITNSSSVPGDPLESTCRHASLALAVVLQRRDWENPGVTQLNR
LAAHPPFASWRNSEEARTDRPSQQLRSLNGEC"
misc_feature 255..311
/label=MCS
/note="MCS"
/note="pUC18/19 multiple cloning site"
primer_bind complement(315..331)
/label=M13 fwd
/note="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 534..558
/label=RB T-DNA repeat
/note="RB T-DNA repeat"
/note="right border repeat from nopaline C58 T-DNA"
CDS 1859..2488
/codon_start=1
/product="stability protein from Pseudomonas plasmid pVS1"
/label=stability protein from Pseudomonas plasmid pVS1
/note="pVS1 StaA"
/translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR
DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP
VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI
LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
CDS 2917..3990
/codon_start=1
/product="replication protein from Pseudomonas plasmid
pVS1"
/label=replication protein from Pseudomonas plasmid
pVS1
/note="pVS1 RepA"
/translation="MSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW
QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS
KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP
GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE
ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR
LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI
LVMRYRNLIEGEASAGS"
rep_origin 4056..4250
/label=pVS1 oriV
/note="pVS1 oriV"
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
misc_feature 4594..4734
/label=bom
/note="bom"
/note="basis of mobility region from pBR322"
rep_origin complement(4920..5508)
/direction=LEFT
/label=ori
/note="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5595..6389)
/codon_start=1
/gene="aphA-3"
/product="aminoglycoside phosphotransferase"
/label=aphA-3
/note="KanR"
/note="confers resistance to kanamycin"
/translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM
TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED
EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT
PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA
FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"
misc_feature 6814..6838
/label=LB T-DNA repeat
/note="LB T-DNA repeat"
/note="left border repeat from nopaline C58 T-DNA"
polyA_signal 6916..7090
/label=CaMV poly(A) signal
/note="CaMV poly(A) signal"
/note="cauliflower mosaic virus polyadenylation signal"
CDS complement(7147..7944)
/codon_start=1
/gene="aph(3')-II (or nptII)"
/product="aminoglycoside phosphotransferase from Tn5"
/label=aph(3')-II (or nptII)
/note="NeoR/KanR"
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin(R))"
/translation="MGIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGR
PVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLL
SSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEH
QGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDI
ALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
promoter complement(8007..8684)
/note="CaMV 35S promoter (enhanced)"
/note="cauliflower mosaic virus 35S promoter with a
duplicated enhancer region"