pPICZ B vector (V010243)

Price Information

Cat No.	Plasmid Name	Availability	Add to cart
V010243	pPICZ B	In stock (lyophilized plasmid)	Buy one, get one free!

Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.

Basic Vector Information

- - Vector Name:
  - pPICZ B
- - Antibiotic Resistance:
  - Bleomycin
- - Length:
  - 3328 bp
- - Type:
  - Yeast Plasmids
- - Replication origin:
  - ori
- - Source/Author:
  - Invitrogen (Life Technologies)
- - Copy Number:
  - High copy number
- - Promoter:
  - AOX1

pPICZ B vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pPICZ B vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_34575        3328 bp DNA     circular SYN 13-SEP-2021
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3328)
  TITLE     Direct Submission
REFERENCE   2  (bases 1 to 3328)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3328
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        2..940
                     /label=AOX1 promoter
                     /note="inducible promoter, regulated by methanol"
     CDS             1010..1039
                     /codon_start=1
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
                     /translation="EQKLISEEDL"
     CDS             1055..1072
                     /codon_start=1
                     /label=6xHis
                     /note="6xHis affinity tag"
                     /translation="HHHHHH"
     terminator      1152..1398
                     /label=AOX1 terminator
                     /note="transcription terminator for AOX1"
     promoter        1413..1824
                     /label=TEF1 promoter
                     /note="promoter for EF-1-alpha"
     promoter        1832..1879
                     /label=EM7 promoter
                     /note="synthetic bacterial promoter"
     CDS             1898..2269
                     /codon_start=1
                     /label=BleoR
                     /note="antibiotic-binding protein"
                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD
                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR
                     EFALRDPAGNCVHFVAEEQD"
     terminator      2338..2585
                     /label=CYC1 terminator
                     /note="transcription terminator for CYC1"
     rep_origin      complement(2660..3248)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"