Basic Vector Information
- Vector Name:
- pPICZ C
- Antibiotic Resistance:
- Bleomycin
- Length:
- 3329 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Source/Author:
- Invitrogen (Life Technologies)
- Copy Number:
- High copy number
- Promoter:
- AOX1
pPICZ C vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPICZ C vector Sequence
LOCUS 40924_34580 3329 bp DNA circular SYN 13-SEP-2021 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3329) TITLE Direct Submission REFERENCE 2 (bases 1 to 3329) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article" FEATURES Location/Qualifiers source 1..3329 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 2..940 /label=AOX1 promoter /note="inducible promoter, regulated by methanol" CDS 1011..1040 /codon_start=1 /label=Myc /note="Myc (human c-Myc proto-oncogene) epitope tag" /translation="EQKLISEEDL" CDS 1056..1073 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 1153..1399 /label=AOX1 terminator /note="transcription terminator for AOX1" promoter 1414..1825 /label=TEF1 promoter /note="promoter for EF-1-alpha" promoter 1833..1880 /label=EM7 promoter /note="synthetic bacterial promoter" CDS 1899..2270 /codon_start=1 /label=BleoR /note="antibiotic-binding protein" /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR EFALRDPAGNCVHFVAEEQD" terminator 2339..2586 /label=CYC1 terminator /note="transcription terminator for CYC1" rep_origin complement(2661..3249) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.