pRS415 vector (Cat. No.: V010221)
Basic Information
- Name:
- pRS415
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7500 bp
- Type:
- Yeast Plasmids
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Sikorski RS, Hieter P.
- Copy Number:
- High copy number
- Promoter:
- GAL1,10
- 5' Primer:
- M13 fwd
- 3' Primer:
- M13 rev
pRS415 vector (Cat. No.: V010221) Sequence
LOCUS 40924_37923 7500 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle vector pRS415, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7500)
AUTHORS Pinto MR, Marchini JF, Buranello PA, Oliver C, Mortara RA, Tosi LR.
TITLE The Leishmania major HTBF protein belongs in the YIP family of
proteins
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7500)
AUTHORS Pinto MR, Marchini JF, Tosi LR.
TITLE Direct Submission
JOURNAL Submitted (13-AUG-2008) Bilogia Celular e Molecular e Bioagentes
Patogenicos, Faculdade de Medicina de Ribeirao Preto, AV.
Bandeirantes, 3900, Ribeirao Preto, Sao Paulo 14049-900, Brasil
REFERENCE 3 (bases 1 to 7500)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7500)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(13-AUG-2008) Bilogia Celular e Molecular e Bioagentes Patogenicos,
Faculdade de Medicina de Ribeirao Preto, AV. Bandeirantes, 3900,
Ribeirao Preto, Sao Paulo 14049-900, Brasil"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7500
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(666..1757)
/label=LEU2
/note="3-isopropylmalate dehydrogenase, required for
leucine biosynthesis"
promoter complement(1770..2174)
/label=LEU2 promoter
rep_origin complement(2474..2929)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 3074..3090
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3100..3118
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind 3144..3160
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
regulatory complement(3181..3267)
/label=GAL 1
/note="GAL 1"
/regulatory_class="promoter"
promoter complement(3272..3936)
/label=GAL1,10 promoter
/note="divergent inducible promoter, regulated by Gal4"
regulatory 3948..4088
/label=GAL10
/note="GAL10"
/regulatory_class="promoter"
CDS 4103..4672
/codon_start=1
/product="HTBF"
/label=HTBF
/note="H region resistance protein; derived from Leishmania
terbinafine"
/protein_id="ACH69155.1"
/translation="MLNEVHVNADPNSISTLDEPVLETLLRDAKAIGRKLVVVVCPSLG
GDKELRDWDLWGPLFLCLILASILTINASDDQGAAVFSAVFIFVWLGGLVVTVNAKLLG
SKIMFFQTYCAMGYCLAPICLGALLCCVLPWFLLNLMLCFMAWAWACWAALRFFRHTVS
ADREVLVVYPVGLFYVFFTWMVLVGI"
primer_bind complement(4673..4689)
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
promoter complement(4726..4744)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(4765..4781)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4789..4805)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4813..4843)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4858..4879)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5167..5755)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5929..6786)
/label=AmpR
/note="beta-lactamase"
promoter complement(6787..6891)
/label=AmpR promoter
misc_feature 6928..7431
/label=CEN/ARS
/note="S. cerevisiae CEN6 centromere fused to an
autonomously replicating sequence"
This page is informational only.