pRS415 vector (V010221)

LOCUS       40924_37923        7500 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle vector pRS415, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7500)
  AUTHORS   Pinto MR, Marchini JF, Buranello PA, Oliver C, Mortara RA, Tosi LR.
  TITLE     The Leishmania major HTBF protein belongs in the YIP family of 
            proteins
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7500)
  AUTHORS   Pinto MR, Marchini JF, Tosi LR.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2008) Bilogia Celular e Molecular e Bioagentes 
            Patogenicos, Faculdade de Medicina de Ribeirao Preto, AV. 
            Bandeirantes, 3900, Ribeirao Preto, Sao Paulo 14049-900, Brasil
REFERENCE   3  (bases 1 to 7500)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7500)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-AUG-2008) Bilogia Celular e Molecular e Bioagentes Patogenicos, 
            Faculdade de Medicina de Ribeirao Preto, AV. Bandeirantes, 3900, 
            Ribeirao Preto, Sao Paulo 14049-900, Brasil"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7500
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(666..1757)
                     /label=LEU2
                     /note="3-isopropylmalate dehydrogenase, required for
                     leucine biosynthesis"
     promoter        complement(1770..2174)
                     /label=LEU2 promoter
     rep_origin      complement(2474..2929)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     3074..3090
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        3100..3118
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     3144..3160
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      complement(3181..3267)
                     /label=GAL 1
                     /note="GAL 1"
                     /regulatory_class="promoter"
     promoter        complement(3272..3936)
                     /label=GAL1,10 promoter
                     /note="divergent inducible promoter, regulated by Gal4"
     regulatory      3948..4088
                     /label=GAL10
                     /note="GAL10"
                     /regulatory_class="promoter"
     CDS             4103..4672
                     /codon_start=1
                     /product="HTBF"
                     /label=HTBF
                     /note="H region resistance protein; derived from Leishmania
                     terbinafine"
                     /protein_id="ACH69155.1"
                     /translation="MLNEVHVNADPNSISTLDEPVLETLLRDAKAIGRKLVVVVCPSLG
                     GDKELRDWDLWGPLFLCLILASILTINASDDQGAAVFSAVFIFVWLGGLVVTVNAKLLG
                     SKIMFFQTYCAMGYCLAPICLGALLCCVLPWFLLNLMLCFMAWAWACWAALRFFRHTVS
                     ADREVLVVYPVGLFYVFFTWMVLVGI"
     primer_bind     complement(4673..4689)
                     /label=SK primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(4726..4744)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(4765..4781)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(4789..4805)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(4813..4843)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(4858..4879)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(5167..5755)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(5929..6786)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(6787..6891)
                     /label=AmpR promoter
     misc_feature    6928..7431
                     /label=CEN/ARS
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"