Basic Vector Information
YEp13 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
YEp13 vector Sequence
LOCUS 40924_49522 10667 bp DNA circular SYN 18-DEC-2018 DEFINITION Yeast episomal vector YEp13, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 10667) AUTHORS Rose AB, Broach JR. TITLE Propagation and expression of cloned genes in yeast: 2-microns circle-based vectors JOURNAL Meth. Enzymol. 185, 234-279 (1990) PUBMED 2199781 REFERENCE 2 (bases 1 to 10667) AUTHORS Stillman DJ. TITLE Direct Submission JOURNAL Submitted (16-NOV-1993) David J. Stillman, Dept. of Cellular, Viral and Molecular Biology, University of Utah Medical Center, Salt Lake City, UT 84132 USA REFERENCE 3 (bases 1 to 10667) TITLE Direct Submission REFERENCE 4 (bases 1 to 10667) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Meth. Enzymol. 185, 234-279 (1990)" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (16-NOV-1993) David J. Stillman, Dept. of Cellular, Viral and Molecular Biology, University of Utah Medical Center, Salt Lake City, UT 84132 USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..10667 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 13..41 /label=tet promoter /note="E. coli promoter for tetracycline efflux protein gene" CDS 89..1276 /codon_start=1 /label=TcR /note="tetracycline efflux protein" /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST" CDS 1920..2108 /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" misc_feature 2213..2353 /label=bom /note="basis of mobility region from pBR322" rep_origin complement(2539..3127) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3301..4158) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="[TEM beta-lactamase fragment, 45 aa] ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS [TEM beta-lactamase fragment, 59 aa] EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA [TEM beta-lactamase fragment, 59 aa] LIKHW" promoter complement(4159..4263) /label=AmpR promoter promoter 5435..5842 /label=LEU2 promoter CDS 5843..6934 /codon_start=1 /label=LEU2 /note="3-isopropylmalate dehydrogenase, required for leucine biosynthesis" /translation="MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHL IGGAAIDATGVPLPDEALEASKKVDAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYA NLRPCNFASDSLLDLSPIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYT VPEVQRITRMAAFMALQHEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQ LIDSAAMILVKNPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAF GLYEPCHGSAPDLPKNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTG DLGGSNSTTEVGDAVAEEVKKILA" rep_origin complement(8988..10330) /direction=LEFT /label=2u ori /note="yeast 2u plasmid origin of replication"
This page is informational only.