Kisspeptin-54 (human) peptide

Kisspeptin-54 (human) peptide

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2

H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

54

98.77%

C₂₅₈H₄₀₁N₇₉O₇₈

5857.41

Synthetic

Powder

KISSPEPTIN IS A 54-amino-acid peptide encoded by the KiSS-1 gene which acts via the G protein-coupled receptor (GPR) GPR54. GPR54 was discovered to be necessary for normal pubertal development when it was demonstrated that mice lacking GPR54 and humans with GPR54-null mutations do not mature sexually and have low circulating gonadotropins and sex hormones (hypogonadotropic hypogonadism). It was also found that kisspeptin in human females potently stimulates LH release in the preovulatory phase and may manipulate the HPG axis in women.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• M.L.Gottsch et al., Endocrinology, 145, 4073 (2004)
• S.B.Seminara and U.B.Kaiser, Endocrinology, 146, 1686 (2005)
• W.S.Dhillo et al., J. Clin. Endocrinol. Metab., 90, 6609 (2005)
• W.S.Dhillo et al., J. Clin. Endocrinol. Metab., 92, 3958 (2007)

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.