Cathelin-related antimicrobial peptide (CRAMP)

Cathelin-related antimicrobial peptide (CRAMP)

• COA/MS/HPLC Report
• Handling and Storage of Synthetic Peptides
• Material Safety Data Sheets (MSDS)

Batch to batch variation of the purity

ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE

H-Ile-Ser-Arg-Leu-Ala-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-OH

38

97.62%

C₁₉₇H₃₃₈N₅₆O₅₀

4291.1

Synthetic

Powder

Cathelin-related antimicrobial peptide has Antibacterial activity. The source of Cathelin-related antimicrobial peptide is Mus musculus [Mouse]. The CRAMP protects the mouse colon from inflammation, cancer, and microbiome disruption. Studies using conditional knockout mice reveal that epithelial cell-derived CRAMP supports colon crypt development, mucus production, and mucosal repair. Conversely, myeloid cell-derived CRAMP enhances epithelial resistance to bacterial invasion during inflammation but exacerbates mucosal damage and mortality. Current studies highlight the coordinated effects of epithelial and myeloid CRAMP in maintaining colon mucosal homeostasis.

Normally, this peptide will be delivered in lyophilized form and should be stored in a freezer at or below -20 °C. For more details, please refer to the manual: Handling and Storage of Synthetic Peptides

• Chen K, Yoshimura T, Yao X, Gong W, Huang J, Dzutsev AK, McCulloch J, O'hUigin C, Bian XW, Trinchieri G, Wang JM. Distinct contributions of cathelin-related antimicrobial peptide (CRAMP) derived from epithelial cells and macrophages to colon mucosal homeostasis. J Pathol. 2021 Mar;253(3):339-350. doi: 10.1002/path.5572. Epub 2021 Jan 19. PMID: 33104252; PMCID: PMC7898386.

Trifluoroacetic acid (TFA) is a common counterion from the purification process using High-Performance Liquid Chromatography (HPLC). The presence of TFA can affect the peptide's net weight, appearance, and solubility.

Impact on Net Weight: The TFA salt contributes to the total mass of the product. In most cases, the peptide content constitutes >80% of the total weight, with TFA accounting for the remainder.

Solubility: TFA salts generally enhance the solubility of peptides in aqueous solutions.

In Biological Assays: For most standard in vitro assays, the residual TFA levels do not cause interference. However, for highly sensitive cellular or biochemical studies, please be aware of its presence.