Human KLHL21 ORF clone (NM_014851) (Cat. No.: V043101)
- Name:
- pCMV-KLHL21(human)-CMV-EGFP-Neo
- Accession ID:
- NM_014851.4
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6318 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418;EGFP
- Copy Number:
- High
- Promoter:
- CMV
- 5' Primer:
- CMV-F
- Growth Strain(s):
- DH5a
- Growth Temperature:
- 37℃
- Expression Method:
- Transient
- Transcript Definition:
- Homo sapiens kelch like family member 21 (KLHL21), transcript variant 1, mRNA
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
Human KLHL21 ORF clone (NM_014851) (Cat. No.: V043101) Sequence
LOCUS V043101 6318 bp DNA circular SYN 01-JAN-1980
DEFINITION synthetic circular DNA.
ACCESSION V043101
VERSION V043101
KEYWORDS .
SOURCE .
ORGANISM .
.
FEATURES Location/Qualifiers
rep_origin complement(62..650)
/direction=LEFT
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
/label="ori"
polyA_signal 979..1026
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
/label="HSV TK poly(A) signal"
CDS complement(1258..2052)
/codon_start=1
/gene="aph(3')-II (or nptII)"
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin®)"
/product="aminoglycoside phosphotransferase from Tn5"
/transl_table=1
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF*"
/label="NeoR/KanR"
promoter complement(2087..2444)
/note="SV40 enhancer and early promoter"
/label="SV40 promoter"
promoter complement(2446..2550)
/gene="bla"
/label="AmpR promoter"
polyA_signal 2579..2700
/note="SV40 polyadenylation signal"
/label="SV40 poly(A) signal"
CDS complement(2823..3542)
/codon_start=1
/note="mammalian codon-optimized"
/product="the original enhanced GFP (Yang et al., 1996)"
/transl_table=1
/translation="M,V,SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFK
DDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMV
LLEFVTAAGITLGMDELYK*"
/label="EGFP"
promoter complement(3610..3813)
/note="human cytomegalovirus (CMV) immediate early
promoter"
/label="CMV promoter"
enhancer 3814..4117
/note="human cytomegalovirus immediate early enhancer"
/label="CMV enhancer"
promoter 4118..4321
/note="human cytomegalovirus (CMV) immediate early
promoter"
/label="CMV promoter"
CDS 4396..6186
/label="KLHL21(NM_014851)"
/note="KLHL21(NM_014851)"
/gene="KLHL21"
polyA_signal 6270..6318
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
/label="HSV TK poly(A) signal"