Human ADAMTS4 ORF clone (NM_005099) (Cat. No.: V018394)
- Name:
- pCMV-Neo-ADAMTS4(human)-Strep-Tag II-EGFP
- Accession ID:
- NM_005099.6
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7349 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418;EGFP
- Promoter:
- CMV
- Fusion Tag:
- Strep-Tag II-EGFP
- Expression Method:
- Transient
- Gene Synonyms:
- ADAMTS-2; ADAMTS-4; ADMP-1
- Transcript Definition:
- Homo sapiens ADAM metallopeptidase with thrombospondin type 1 motif 4 (ADAMTS4), transcript variant 1, mRNA
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
Human ADAMTS4 ORF clone (NM_005099) (Cat. No.: V018394) Sequence
LOCUS V018394 7349 bp DNA circular SYN 01-JAN-1980
DEFINITION synthetic circular DNA.
ACCESSION V018394
VERSION V018394
KEYWORDS .
SOURCE .
ORGANISM .
.
FEATURES Location/Qualifiers
enhancer 61..364
/note="human cytomegalovirus immediate early enhancer"
/label="CMV enhancer"
promoter 365..568
/note="human cytomegalovirus (CMV) immediate early
promoter"
/label="CMV promoter"
CDS 625..3135
/label="ADAMTS4(NM_005099)"
/note="ADAMTS4(NM_005099)"
/gene="ADAMTS4"
CDS 3160..3177
/codon_start=1
/product="thrombin recognition and cleavage site"
/transl_table=1
/translation="LVPRGS"
/label="thrombin site"
CDS 3190..3273
/codon_start=1
/product="two Strep-Tag®II moieties connected by a linker
for enhanced binding to Strep-Tactin®, an engineered
form of streptavidin (Schmidt et al., 2013)"
/transl_table=1
/translation="WSHPQFEK,GGGSGGGSGGSA,WSHPQFEK"
/label="Twin-Strep-tag"
CDS 3295..4014
/codon_start=1
/note="mammalian codon-optimized"
/product="the original enhanced GFP (Yang et al., 1996)"
/transl_table=1
/translation="M,V,SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL
TLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFK
DDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNG
IKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMV
LLEFVTAAGITLGMDELYK*"
/label="EGFP"
polyA_signal 4137..4258
/note="SV40 polyadenylation signal"
/label="SV40 poly(A) signal"
rep_origin complement(4265..4720)
/direction=LEFT
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
/label="f1 ori"
promoter 4747..4851
/gene="bla"
/label="AmpR promoter"
promoter 4853..5210
/note="SV40 enhancer and early promoter"
/label="SV40 promoter"
CDS 5245..6039
/codon_start=1
/gene="aph(3')-II (or nptII)"
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin®)"
/product="aminoglycoside phosphotransferase from Tn5"
/transl_table=1
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF*"
/label="NeoR/KanR"
polyA_signal 6271..6318
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
/label="HSV TK poly(A) signal"
rep_origin 6647..7235
/direction=RIGHT
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
/label="ori"