Mouse Mbd2 ORF clone (NM_010773) (Cat. No.: V018289)

pCMV-SV40-Neo-Mbd2(mouse)-FLAG5542 bp60012001800240030003600420048005400CMV enhancerCMV promoterT3 promoterFLAGMbd2(NM_010773)T7 promoterSV40 poly(A) signalf1 oriAmpR promoterSV40 promoterNeoR/KanRHSV TK poly(A) signalori
Basic Information
Name:
pCMV-SV40-Neo-Mbd2(mouse)-FLAG
Accession ID:
NM_010773.2
Antibiotic Resistance:
Kanamycin
Length:
5542 bp
Type:
Protein expression
Replication origin:
ori
Host:
Mammalian cells
Selection Marker:
Neo/G418
Promoter:
CMV
Fusion Tag:
FLAG
Expression Method:
Transient
Gene Synonyms:
MBD2a
Transcript Definition:
Mus musculus methyl-CpG binding domain protein 2 (Mbd2), transcript variant 1, mRNA
Cat. No.: V018289 pCMV-SV40-Neo-Mbd2(mouse)-FLAG
$ 299.6
In stock, 1-2 weeks for quality controls
Buy one, get one free! (?)
Two tubes of transfection grade plasmid, each tube is about 100 µg (lyophilized).
Transcript ID
Fusion Tag
Selection Marker

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

Mouse Mbd2 ORF clone (NM_010773) (Cat. No.: V018289) Sequence

LOCUS       V018289                 5542 bp    DNA     circular SYN 01-JAN-1980
DEFINITION  synthetic circular DNA.
ACCESSION   V018289
VERSION     V018289
KEYWORDS    .
SOURCE      .
  ORGANISM  .
            .
FEATURES             Location/Qualifiers
     enhancer        67..370
                     /note="human cytomegalovirus immediate early enhancer"
                     /label="CMV enhancer"
     promoter        371..574
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
                     /label="CMV promoter"
     promoter        620..638
                     /note="promoter for bacteriophage T3 RNA polymerase"
                     /label="T3 promoter"
     regulatory      673..682
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
                     /label="Kozak sequence"
     CDS             682..705
                     /codon_start=1
                     /product="FLAG® epitope tag, followed by an enterokinase
                     cleavage site"
                     /transl_table=1
                     /translation="DYKDDDDK"
                     /label="FLAG"
     CDS             739..1980
                     /label="Mbd2(NM_010773)"
                     /note="Mbd2(NM_010773)"
                     /gene="Mbd2"
     promoter        complement(2044..2062)
                     /note="promoter for bacteriophage T7 RNA polymerase"
                     /label="T7 promoter"
     polyA_signal    2336..2457
                     /note="SV40 polyadenylation signal"
                     /label="SV40 poly(A) signal"
     rep_origin      complement(2464..2919)
                     /direction=LEFT
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
                     /label="f1 ori"
     promoter        2946..3050
                     /gene="bla"
                     /label="AmpR promoter"
     promoter        3052..3409
                     /note="SV40 enhancer and early promoter"
                     /label="SV40 promoter"
     CDS             3444..4238
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /note="confers resistance to neomycin, kanamycin, and G418
                     (Geneticin®)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /transl_table=1
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF*"
                     /label="NeoR/KanR"
     polyA_signal    4470..4517
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
                     /label="HSV TK poly(A) signal"
     rep_origin      4846..5434
                     /direction=RIGHT
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
                     /label="ori"