Human TET2 ORF clone (NM_001127208) (Cat. No.: V018216)
- Name:
- pEnCMV-TET2(human)-Myc-FLAG-SV40-Neo
- Accession ID:
- NM_001127208.3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 10887 bp
- Type:
- Protein expression
- Replication origin:
- ori
- Host:
- Mammalian cells
- Selection Marker:
- Neo/G418
- Promoter:
- CMV
- Fusion Tag:
- Myc-FLAG
- Expression Method:
- Transient
- Gene Synonyms:
- IMD75; KIAA1546; MDS
- Transcript Definition:
- Homo sapiens tet methylcytosine dioxygenase 2 (TET2), transcript variant 1, mRNA
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
Human TET2 ORF clone (NM_001127208) (Cat. No.: V018216) Sequence
LOCUS V018216 10887 bp DNA circular SYN 01-JAN-1980
DEFINITION synthetic circular DNA.
ACCESSION V018216
VERSION V018216
KEYWORDS .
SOURCE .
ORGANISM .
.
FEATURES Location/Qualifiers
primer_bind 166..182
/note="common sequencing primer, one of multiple similar
variants"
/label="M13 fwd"
enhancer 343..722
/note="human cytomegalovirus immediate early enhancer"
/label="CMV enhancer"
promoter 723..926
/note="human cytomegalovirus (CMV) immediate early
promoter"
/label="CMV promoter"
promoter 952..970
/note="promoter for bacteriophage T7 RNA polymerase"
/label="T7 promoter"
CDS 1029..7034
/label="TET2(NM_001127208)"
/note="TET2(NM_001127208)"
/gene="TET2"
CDS 7053..7082
/codon_start=1
/product="Myc (human c-Myc proto-oncogene) epitope tag"
/transl_table=1
/translation="EQKLISEEDL"
/label="Myc"
CDS 7101..7124
/codon_start=1
/product="FLAG® epitope tag, followed by an enterokinase
cleavage site"
/transl_table=1
/translation="DYKDDDDK"
/label="FLAG"
primer_bind complement(7144..7160)
/note="common sequencing primer, one of multiple similar
variants"
/label="M13 rev"
polyA_signal 7171..7793
/note="human growth hormone polyadenylation signal"
/label="hGH poly(A) signal"
rep_origin complement(7942..8530)
/direction=LEFT
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
/label="ori"
polyA_signal 8859..8906
/note="herpes simplex virus thymidine kinase
polyadenylation signal (Cole and Stacy, 1985)"
/label="HSV TK poly(A) signal"
CDS complement(9138..9932)
/codon_start=1
/gene="aph(3')-II (or nptII)"
/note="confers resistance to neomycin, kanamycin, and G418
(Geneticin®)"
/product="aminoglycoside phosphotransferase from Tn5"
/transl_table=1
/translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF*"
/label="NeoR/KanR"
promoter complement(9967..10324)
/note="SV40 enhancer and early promoter"
/label="SV40 promoter"
promoter complement(10326..10430)
/gene="bla"
/label="AmpR promoter"
rep_origin 10457..10885
/direction=RIGHT
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
/label="f1 ori"