Basic Vector Information
- Vector Name:
- pSI-DGB2x
- Antibiotic Resistance:
- Gentamycin
- Length:
- 4308 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer K, Berger P.
pSI-DGB2x vector Map
pSI-DGB2x vector Sequence
LOCUS 40924_40252 4308 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pSI-DGB2x, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4308)
AUTHORS Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer
K, Berger P.
TITLE A plasmid-based multigene expression system for mammalian cells
JOURNAL Nat Commun 1, 120 (2010)
PUBMED 21081918
REFERENCE 2 (bases 1 to 4308)
AUTHORS Kriz A, Schmid K, Baumgartner N, Ziegler U, Berger I, Ballmer-Hofer
K, Berger P.
TITLE Direct Submission
JOURNAL Submitted (11-OCT-2010) Laboratory of Biomolecular Research, Paul
Scherrer Institut, OFLC / 101, Villigen PSI CH-5232, Switzerland
REFERENCE 3 (bases 1 to 4308)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4308)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat Commun
1, 120 (2010)"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-OCT-2010) Laboratory of Biomolecular Research, Paul Scherrer
Institut, OFLC / 101, Villigen PSI CH-5232, Switzerland"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4308
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 71..374
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 375..578
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 623..641
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 703..1419
/codon_start=1
/label=EBFP2
/note="enhanced blue variant of GFP (Ai et al., 2007)"
/translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTL
KFICTTGKLPVPWPTLVTTLSHGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
GTYKTRAEVKFEGDTLVNRIELKGVDFKEDGNILGHKLEYNFNSHNIYIMAVKQKNGIK
VNFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSVLSKDPNEKRDHMVLL
EFRTAAGITLGMDELYK"
protein_bind 1478..1499
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1514..1544
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 1552..1568
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 1576..1592
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
RBS 1619..1641
/label=RBS
/note="efficient ribosome binding site from bacteriophage
T7 gene 10 (Olins and Rangwala, 1989)"
CDS 1766..2473
/codon_start=1
/label=GFP
/note="Aequorea victoria green fluorescent protein"
/translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF
ICTTGKLPVPWPTLVTTLCYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN
YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN
FKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF
VTAAGITHGMDELY"
polyA_signal 2666..2890
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
CDS complement(3116..3646)
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
rep_origin complement(3844..4225)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
protein_bind complement(4267..4300)
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
This page is informational only.