Basic Vector Information
- Vector Name:
- pSH068
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5544 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Hon S, Olson DG, Holwerda EK, Lanahan AA, Murphy SJL., Maloney MI, Zheng T, Papanek B, Guss AM, Lynd LR.
pSH068 vector Map
pSH068 vector Sequence
LOCUS V003251 5544 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V003251
VERSION V003251
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 5544)
AUTHORS Hon S, Olson DG, Holwerda EK, Lanahan AA, Murphy SJL., Maloney MI,
Zheng T, Papanek B, Guss AM, Lynd LR.
TITLE The ethanol pathway from Thermoanaerobacterium saccharolyticum
improves ethanol production in Clostridium thermocellum
JOURNAL Metab. Eng. 42, 175-184 (2017)
PUBMED 28663138
REFERENCE 2 (bases 1 to 5544)
AUTHORS Hon S, Olson DG, Holwerda EK, Lanahan AA, Murphy SJL., Maloney MI,
Zheng T, Papanek BA, Guss AM, Lynd LR.
TITLE Direct Submission
JOURNAL Submitted (27-MAR-2017) Thayer School of Engineering, Dartmouth
College, 14 Engineering Drive, Hanover, NH 03755, USA
REFERENCE 3 (bases 1 to 5544)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5544)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName: "Metab. Eng.
42, 175-184 (2017)"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(27-MAR-2017) Thayer School of Engineering, Dartmouth College, 14
Engineering Drive, Hanover, NH 03755, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5544
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 1..92
/label="cat promoter"
/note="cat promoter"
/regulatory_class="promoter"
CDS 93..740
/gene="cat"
/label="Chloramphenicol acetyltransferase"
/note="Chloramphenicol acetyltransferase from
Staphylococcus aureus. Accession#: P00485"
CDS complement(824..1681)
/label="AmpR"
/note="beta-lactamase"
promoter complement(1682..1773)
/label="AmpR promoter"
rep_origin 2033..2578
/direction=RIGHT
/label="p15A ori"
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS 3049..4050
/label="repB"
/note="RepB replication protein"
regulatory 4099..4307
/label="Clo1313_2638 promoter"
/note="Clo1313_2638 promoter"
/regulatory_class="promoter"
CDS 4308..5507
/codon_start=1
/gene="adhA"
/product="AdhA"
/label="adhA"
/note="NADPH-dependent alcohol dehydrogenase"
/protein_id="ASK86064.1"
/translation="MWETKVNPSKIFELRCKNTTYFGVGSIHKIKDILENLKINGINNV
IFITGKGSYKTSGAWDVVRPVLEELDLKYSLYDKVGPNPTVDMIDEAAKIGRESGAKAV
IGIGGGSPIDTAKSVAVLLKYTDKNARELYKQKFIPDDAVPIIAINLTHGTGTEVDRFA
VATIPEKNYKPAIAYDCLYPMFAIDDPSLMTKLDKKQTIAVTVDALNHITEAATTLVAS
PYSILTAKETVRLIVRYLPAAVNDPLNIVARYYLLYASALAGISFDNGLLHLTHALEHP
LSAVKPEIAHGLGLGAILPAVIKAIYPATAEVLADVYSPIVPGLKGLPVEAEYVAEKVQ
EWLFSVGCIQKLSDFGFTKDDIPNLVKLAKTTPSLDGLLSIAPVEATESVIEKIYLKSL
"
gene 4308..5507
/gene="adhA"
/label="adhA"
This page is informational only.