Basic Vector Information
- Vector Name:
- pSEVA614
- Antibiotic Resistance:
- Gentamycin
- Length:
- 3298 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B, Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez G, Kim J, Nikel PI, Platero R, de Lorenzo V.
pSEVA614 vector Map
pSEVA614 vector Sequence
LOCUS 40924_39598 3298 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pSEVA614, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3298)
AUTHORS Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B,
Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez
G, Kim J, Nikel PI, Platero R, de Lorenzo V.
TITLE The Standard European Vector Architecture (SEVA): a coherent
platform for analysis and deployment of complex prokaryotic
phenotypes
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3298)
AUTHORS Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B,
Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez
G, Kim J, Nikel PI, Platero R, de Lorenzo V.
TITLE Direct Submission
JOURNAL Submitted (28-AUG-2012) Systems Biology Program, Centro Nacional de
Biotecnologia-CSIC, C/ Darwin 3, Campus de Cantoblanco, Madrid,
Madrid 28049, Spain
REFERENCE 3 (bases 1 to 3298)
AUTHORS Silva-Rocha R, Martinez-Garcia E, Chavarria M, Calles B,
Arce-Rodriguez A, de las Heras A, Paez-Espino D, Durante-Rodriguez
G, Kim J, Nikel PI, Platero R, de Lorenzo V.
TITLE Direct Submission
JOURNAL Submitted (25-SEP-2014) Systems Biology Program, Centro Nacional de
Biotecnologia-CSIC, C/ Darwin 3, Campus de Cantoblanco, Madrid,
Madrid 28049, Spain
REFERENCE 4 (bases 1 to 3298)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 3298)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(28-AUG-2012) Systems Biology Program, Centro Nacional de
Biotecnologia-CSIC, C/ Darwin 3, Campus de Cantoblanco, Madrid,
Madrid 28049, Spain"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(25-SEP-2014) Systems Biology Program, Centro Nacional de
Biotecnologia-CSIC, C/ Darwin 3, Campus de Cantoblanco, Madrid,
Madrid 28049, Spain"
COMMENT SGRef: number: 4; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: ApE v. v2.0.40
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
On Sep 25, 2014 this sequence version replaced JX560386.1.
FEATURES Location/Qualifiers
source 1..3298
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 11..88
/label=lacIq promoter
/note="In the lacIq allele, a single base change in the
promoter boosts expression of the lacI gene about 10-fold."
CDS 89..1168
/codon_start=1
/label=lacI
/note="lac repressor"
/translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL
NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV
EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH
EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA
MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC
YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR
ALADSLMQLARQVSRLESGQ"
promoter 1403..1432
/label=trc promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind 1440..1456
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
misc_feature 1483..1539
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(1548..1571)
/label=F24
/note="F24"
terminator 1582..1676
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
promoter 1707..1735
/label=Pc promoter
/note="class 1 integron promoter"
CDS 1924..2454
/codon_start=1
/label=GmR
/note="gentamycin acetyltransferase"
/translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQPRS
EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
EEVMHFDIDPSTAT"
oriT 2668..2776
/label=oriT
/note="incP origin of transfer"
rep_origin 2787..3175
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
terminator complement(3206..3292)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.