pSET4s vector (Cat. No.: V003383)

pSET4s4505 bp600120018002400300036004200orfCrepAtslacZ'lac operatorlac promoterCAP binding siteorispc
Basic Information

Note: pSET4s, pSET5s, and pSET6s are three thermosensitive (Ts) suicide vectors used for gene replacement in Streptococcus suis. These vectors could be propagated at 37°C in Escherichia coli, but their replication was blocked above 37°C in S. suis. orfC, replication regulatory protein; repATs, thermosensitive replication initiation–termination protein.

Name:
pSET4s
Antibiotic Resistance:
Spectinomycin
Length:
4505 bp
Type:
Thermosensitive suicide vector
Replication origin:
ori
Source/Author:
Takamatsu D, Osaki M, Sekizaki T.
Growth Strain(s):
DH10B
Growth Temperature:
37℃
$ 199.3
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pSET4s vector (Cat. No.: V003383) Sequence

LOCUS       Exported                4505 bp DNA     circular SYN 02-SEP-2024
DEFINITION  Thermosensitive suicide vector pSET4s DNA, complete sequence.
ACCESSION   AB055650
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4505)
  AUTHORS   Takamatsu D, Osaki M, Sekizaki T.
  TITLE     Thermosensitive suicide vectors for gene replacement in 
            Streptococcus suis
  JOURNAL   Plasmid 46 (2), 140-148 (2001)
  PUBMED    11591139
REFERENCE   2  (bases 1 to 4505)
  AUTHORS   Takamatsu D, Osaki M, Sekizaki T.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2001) Daisuke Takamatsu, National Institute of 
            Animal Health, Laboratory of Molecular Bacteriology; Kannondai 
            3-1-1, Tsukuba, Ibaraki 305-0856, Japan 
            (E-mail:p1013dt@niah.affrc.go.jp, Tel:81-298-38-7743, 
            Fax:81-298-38-7743)
REFERENCE   3  (bases 1 to 4505)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; 
            date: "2001"; volume: "46"; issue: "2"; pages: "140-148"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (08-FEB-2001) Daisuke Takamatsu, National Institute of Animal 
            Health, Laboratory of Molecular Bacteriology"; volume: " Kannondai 
            3-1-1, Tsukuba, Ibaraki 305-0856, Japan 
            (E-mail:p1013dt@niah.affrc.go.jp, Tel:81-298-38-7743, Fax"; pages: 
            "81-298-38-7743"
FEATURES             Location/Qualifiers
     source          1..4505
                     /mol_type="other DNA"
                     /db_xref="taxon:152114"
                     /organism="Thermosensitive suicide vector pSET4s"
     gene            528..689
                     /gene="orfC"
                     /label=orfC
     CDS             528..689
                     /codon_start=1
                     /gene="orfC"
                     /product="ORFC"
                     /label=orfC
                     /protein_id="BAB64880.1"
                     /translation="MVISESKKRVMISLTKEQDKKLTDMAKQKGFSKSAVAALAIEEYA
                     RKKSEQKK"
     gene            756..1454
                     /gene="repAts"
                     /label=repAts
     CDS             756..1454
                     /codon_start=1
                     /gene="repAts"
                     /product="RepAts"
                     /label=repAts
                     /protein_id="BAB64881.1"
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     gene            complement(1803..2126)
                     /gene="lacZ'"
                     /label=lacZ'
     CDS             complement(1803..2126)
                     /codon_start=1
                     /gene="lacZ'"
                     /product="LacZ'"
                     /label=lacZ'
                     /protein_id="BAB64882.1"
                     /translation="MTMITPSLHACRSTLEDPRVPSSNSLAVVLQRRDWENPGVTQLNR
                     LAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYFLLTHLCGISHRIWCTLSTICS
                     DAA"
     primer_bind     2036..2052
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    2053..2109
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(2122..2138)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    2146..2162
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(2170..2200)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2215..2236
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      complement(2524..3112)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     gene            3637..4404
                     /gene="spc"
                     /label=spc
     CDS             3637..4404
                     /codon_start=1
                     /gene="spc"
                     /product="spectinomycin adenyltransferase"
                     /label=spc
                     /protein_id="BAB64883.1"
                     /translation="MRRIYLNTYEQINKVKKILRKHLKNNLIGTYMFGSGVESGLKPNS
                     DLDFLVVVSEPLTDQSKEILIQKIRPISKKIGDKSNLRYIELTIIIQQEMVPWNHPPKQ
                     EFIYGEWLQELYEQGYIPQKELNSDLTIMLYQAKRKNKRIYGNYDLEELLPDIPFSDVR
                     RAIMDSSEELIDNYQDDETNSILTLCRMILTMDTGKIIPKDIAGNAVAESSPLEHRERI
                     LLAVRSYLGENIEWTNENVNLTINYLNNRLKKL"