Basic Vector Information
- Vector Name:
- pTKIP-tri
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3726 bp
- Type:
- Donor vector
- Replication origin:
- ori
- Source/Author:
- Kuhlman TE, Cox EC.
- Promoter:
- mPGK
pTKIP-tri vector Map
pTKIP-tri vector Sequence
LOCUS 40924_43558 3726 bp DNA circular SYN 18-DEC-2018
DEFINITION Donor vector pTKIP-tri, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3726)
AUTHORS Kuhlman TE, Cox EC.
TITLE Site-specific chromosomal integration of large synthetic constructs
JOURNAL Nucleic Acids Res. 38 (6), E92 (2010)
PUBMED 20047970
REFERENCE 2 (bases 1 to 3726)
AUTHORS Kuhlman TE, Cox EC.
TITLE Direct Submission
JOURNAL Submitted (17-DEC-2009) Molecular Biology, Princeton University,
Washington Rd., Princeton, NJ 08544, USA
REFERENCE 3 (bases 1 to 3726)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3726)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nucleic
Acids Res."; date: "2010"; volume: "38"; issue: "6"; pages: "E92"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(17-DEC-2009) Molecular Biology, Princeton University, Washington
Rd., Princeton, NJ 08544, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3726
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 238..426
/codon_start=1
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
/translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
DELYRSCLARFGDDGENL"
misc_feature 531..671
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(857..1445)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(1619..2476)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
promoter complement(2477..2581)
/label=AmpR promoter
misc_feature 2607..2624
/label=I-SceI recognition site
/note="I-SceI recognition site"
misc_feature 2625..2649
/label=Landing Pad Region 1
/note="Landing Pad Region 1"
primer_bind 2668..2684
/label=KS primer
/note="common sequencing primer, one of multiple similar
variants"
protein_bind 2706..2739
/label=FRT (minimal)
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
promoter 2803..3302
/label=PGK promoter
/note="mouse phosphoglycerate kinase 1 promoter"
promoter 3314..3361
/label=EM7 promoter
/note="synthetic bacterial promoter"
CDS 3380..3613
/codon_start=1
/label=TpR
/note="E. coli plasmid-associated dihydrofolate reductase"
/translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
misc_feature 3650..3683
/label=FRT
/note="FRT"
protein_bind 3650..3683
/label=FRT (minimal)
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
misc_feature 3684..3708
/label=Landing Pad Region 2
/note="Landing Pad Region 2"
misc_feature 3709..3726
/label=I-SceI recognition site
/note="I-SceI recognition site"
This page is informational only.