pTip-LCH2 vector (V002640)

Basic Vector Information

      • Vector Name:
      • pTip-LCH2
      • Antibiotic Resistance:
      • Tetracycline
      • Length:
      • 8184 bp
      • Type:
      • Expression vector
      • Replication origin:
      • ori
      • Source/Author:
      • Nakashima N, Tamura T.

pTip-LCH2 vector Vector Map

pTip-LCH28184 bp400800120016002000240028003200360040004400480052005600600064006800720076008000tsnRTcRtipAAmpR promoterAmpRori6xHisRBSRepARepB

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pTip-LCH2 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_43398        8184 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Expression vector pTip-LCH2 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8184)
  AUTHORS   Nakashima N, Tamura T.
  TITLE     A novel system for expressing recombinant proteins over a wide 
            temperature range from 4 to 35 degrees C
  JOURNAL   Biotechnol. Bioeng. 86 (2), 136-148 (2004)
  PUBMED    15052633
REFERENCE   2  (bases 1 to 8184)
  AUTHORS   Nakashima N, Tamura T.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2002) Nobutaka Nakashima, National Institute of 
            Advanced Industrial Science and Technology; Tsukisamu-Higashi 
            2-17-2-1, Sapporo, Toyohira-ku 062-8517, Japan 
            (E-mail:n-nakashima@aist.go.jp, Tel:81-11-857-8937)
REFERENCE   3  (bases 1 to 8184)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8184)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol.
            Bioeng."; date: "2004"; volume: "86"; issue: "2"; pages: "136-148"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (18-OCT-2002) Nobutaka Nakashima, National Institute of Advanced 
            Industrial Science and Technology"; volume: " Tsukisamu-Higashi 
            2-17-2-1, Sapporo, Toyohira-ku 062-8517, Japan 
            (E-mail:n-nakashima@aist.go.jp, Tel"; pages: "81-11-857-8937"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8184
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             170..976
                     /gene="tsnR"
                     /label=tsnR
                     /note="23S rRNA (adenosine(1067)-2'-O)-methyltransferase
                     from Streptomyces azureus. Accession#: P18644"
     regulatory      1145..1324
                     /gene="Tuf1"
                     /regulatory_class="promoter"
     gene            1145..1324
                     /gene="Tuf1"
                     /label=Tuf1
     CDS             1325..2512
                     /label=TcR
                     /note="tetracycline efflux protein"
     regulatory      2728..2903
                     /gene="ThcA"
                     /regulatory_class="promoter"
     gene            2728..2903
                     /gene="ThcA"
                     /label=ThcA
     CDS             2904..3662
                     /gene="tipA"
                     /label=tipA
                     /note="HTH-type transcriptional activator TipA from
                     Streptomyces lividans. Accession#: P0A4T9"
     promoter        3843..3947
                     /label=AmpR promoter
     CDS             3948..4805
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      4979..5567
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     regulatory      complement(5818..5998)
                     /gene="ThcA"
                     /regulatory_class="terminator"
     gene            complement(5818..5998)
                     /gene="ThcA"
                     /label=ThcA
     CDS             complement(6012..6029)
                     /label=6xHis
                     /note="6xHis affinity tag"
     RBS             complement(6085..6107)
                     /label=RBS
                     /note="efficient ribosome binding site from bacteriophage
                     T7 gene 10 (Olins and Rangwala, 1989)"
     regulatory      complement(6121..6244)
                     /gene="TipA"
                     /regulatory_class="promoter"
     CDS             6783..7670
                     /codon_start=1
                     /gene="RepA"
                     /label=RepA
                     /protein_id="BAD11254.1"
                     /translation="MKSATGGVLSDRQWADAVLLPHRPFATNNLQRGQYRMSRDDALAM
                     RYVEHSPHALLGSIVIDCDHVDAAMRAFEQPSDHPAPNWVAQSPSGRAHIGWWLGPNHV
                     CRTDSARLTPLRYAHRIETGLKISVGGDFAYGGQLTKNPIHPDWETIYGPATPYTLRQL
                     ATIHTPRQMPRRPDRAVGLGRNVTMFDATRRWAYPQWWQHRNGTGRDWDHLVLQHCHAV
                     NTEFTTPLPFTEVRATAQSISKWIWRNFTEEQYRARQAHLGQKGGKATTLAKQEAVRNN
                     ARKYDEHTMREAII"
     gene            6783..7670
                     /gene="RepA"
                     /label=RepA
     CDS             7670..7954
                     /codon_start=1
                     /gene="RepB"
                     /label=RepB
                     /protein_id="BAD11255.1"
                     /translation="MGGAKNPVRRKMTAAAAAEKFGASTRTIQRLFAEPRDDYLGRAKA
                     RRDKAVELRKQGLKYREIAEAMELSTGIVGRLLHDARRHGEISAEDLSA"
     gene            7670..7954
                     /gene="RepB"
                     /label=RepB

This page is informational only.