Basic Vector Information
- Vector Name:
- pTip-CH1.2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8337 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Nakashima N, Tamura T.
pTip-CH1.2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pTip-CH1.2 vector Sequence
LOCUS 40924_43373 8337 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pTip-CH1.2 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8337) AUTHORS Nakashima N, Tamura T. TITLE A novel system for expressing recombinant proteins over a wide temperature range from 4 to 35 degrees C JOURNAL Biotechnol. Bioeng. 86 (2), 136-148 (2004) PUBMED 15052633 REFERENCE 2 (bases 1 to 8337) AUTHORS Nakashima N, Tamura T. TITLE Direct Submission JOURNAL Submitted (18-OCT-2002) Nobutaka Nakashima, National Institute of Advanced Industrial Science and Technology; Tsukisamu-Higashi 2-17-2-1, Sapporo, Toyohira-ku 062-8517, Japan (E-mail:n-nakashima@aist.go.jp, Tel:81-11-857-8937) REFERENCE 3 (bases 1 to 8337) TITLE Direct Submission REFERENCE 4 (bases 1 to 8337) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Biotechnol. Bioeng."; date: "2004"; volume: "86"; issue: "2"; pages: "136-148" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (18-OCT-2002) Nobutaka Nakashima, National Institute of Advanced Industrial Science and Technology"; volume: " Tsukisamu-Higashi 2-17-2-1, Sapporo, Toyohira-ku 062-8517, Japan (E-mail:n-nakashima@aist.go.jp, Tel"; pages: "81-11-857-8937" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8337 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 170..976 /gene="tsnR" /label=tsnR /note="23S rRNA (adenosine(1067)-2'-O)-methyltransferase from Streptomyces azureus. Accession#: P18644" CDS 1541..2716 /codon_start=1 /gene="Chlr" /product="chloramphenicol resistance protein" /label=Chlr /protein_id="BAD11263.1" /translation="VPFAIYVLGLAVFAQGTSEFMLSGLIPDMARDLGVSVPAAGLLTS AFAVGMIIGAPLMAIASMRWPRRRALLTFLITFMLVHVIGALTSSFEVLLVTRIVGALA NAGFLAVALGAAMAMVPADMKGRATSVLLGGVTIACVAGVPGGAFLGEMWGWRAAFWAV VVISAPAVVAIMFATPAEPLAESTPNAKRELSSLRSRKLQLMLVLGALINGATFCSFTY MAPTLTDISGFDSRWIPLLLGLFGLGSFIGVSVGGRLADTRPFQLLAVGSAALLTGWIV FALTASHPAVTLVMLFVQGALSFAVGSTLISQVLYAADAAPTLGGSFATAAFNVGAALG PALGGLAIGMGLSYRAPLWTSAALVTLAIVIGAATLSLWRRPASVHESVPA" gene 1541..2716 /gene="Chlr" /label=Chlr regulatory 2905..3080 /gene="ThcA" /regulatory_class="promoter" gene 2905..3080 /gene="ThcA" /label=ThcA CDS 3081..3839 /gene="tipA" /label=tipA /note="HTH-type transcriptional activator TipA from Streptomyces lividans. Accession#: P0A4T9" promoter 4020..4124 /label=AmpR promoter CDS 4125..4982 /label=AmpR /note="beta-lactamase" rep_origin 5156..5744 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" regulatory complement(5995..6175) /gene="ThcA" /regulatory_class="terminator" gene complement(5995..6175) /gene="ThcA" /label=ThcA CDS complement(6189..6206) /label=6xHis /note="6xHis affinity tag" gene complement(6255..6497) /gene="TipA" /label=TipA regulatory complement(6255..6273) /gene="TipA" /regulatory_class="ribosome_binding_site" regulatory complement(6274..6497) /gene="TipA" /regulatory_class="promoter" CDS 6936..7823 /codon_start=1 /gene="RepA" /label=RepA /protein_id="BAD11266.1" /translation="MKSATGGVLSDRQWADAVLLPHRPFATNNLQRGQYRMSRDDALAM RYVEHSPHALLGSIVIDCDHVDAAMRAFEQPSDHPAPNWVAQSPSGRAHIGWWLGPNHV CRTDSARLTPLRYAHRIETGLKISVGGDFAYGGQLTKNPIHPDWETIYGPATPYTLRQL ATIHTPRQMPRRPDRAVGLGRNVTMFDATRRWAYPQWWQHRNGTGRDWDHLVLQHCHAV NTEFTTPLPFTEVRATAQSISKWIWRNFTEEQYRARQAHLGQKGGKATTLAKQEAVRNN ARKYDEHTMREAII" gene 6936..7823 /gene="RepA" /label=RepA CDS 7823..8107 /codon_start=1 /gene="RepB" /label=RepB /protein_id="BAD11267.1" /translation="MGGAKNPVRRKMTAAAAAEKFGASTRTIQRLFAEPRDDYLGRAKA RRDKAVELRKQGLKYREIAEAMELSTGIVGRLLHDARRHGEISAEDLSA" gene 7823..8107 /gene="RepB" /label=RepB
This page is informational only.