Basic Vector Information
pSC101 ori is a low-copy replication origin that requires the Rep101 protein, which is a temperature-sensitive protein. When bacteria containing a plasmid with this ori is cultured at 37℃, the plasmid will be lost.
- Vector Name:
- pTH19cs5
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3064 bp
- Type:
- Cloning vector
- Replication origin:
- pSC101 ori
- Source/Author:
- Hashimoto-Gotoh T, Yamaguchi M, Yasojima K, Tsujimura A, Wakabayashi Y, Watanabe Y.
- Copy Number:
- Low Copy
- Growth Temperature:
- 30℃
pTH19cs5 vector Map
pTH19cs5 vector Sequence
LOCUS 40924_43233 3064 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pTH19cs5 DNA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3064)
AUTHORS Hashimoto-Gotoh T, Yamaguchi M, Yasojima K, Tsujimura A, Wakabayashi
Y, Watanabe Y.
TITLE A set of temperature sensitive-replication/-segregation and
temperature resistant plasmid vectors with different copy numbers
and in an isogenic background (chloramphenicol, kanamycin, lacZ,
repA, par, polA)
JOURNAL Gene 241 (1), 185-191 (2000)
PUBMED 10607913
REFERENCE 2 (bases 1 to 3064)
AUTHORS Hashimoto-Gotoh T.
TITLE Direct Submission
JOURNAL Submitted (10-NOV-1998) Contact:Tamotsu Hashimoto-Gotoh Res. Inst.
for Geriatrics, Kyoto Pref. Univ. Med., Biochem. and Mol. Genet.;
Kawaramachi-Hirokoji, Kajii-Cho 465, Kamigyo-ku, Kyoto, Kyoto
602-8566, Japan
REFERENCE 3 (bases 1 to 3064)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3064)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene";
date: "2000"; volume: "241"; issue: "1"; pages: "185-191"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(10-NOV-1998) Contact:Tamotsu Hashimoto-Gotoh Res. Inst. for
Geriatrics, Kyoto Pref. Univ. Med., Biochem. and Mol. Genet.;
Kawaramachi-Hirokoji, Kajii-Cho 465, Kamigyo-ku, Kyoto, Kyoto
602-8566, Japan"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT On Jun 23, 1999 this sequence version replaced AB019614.1.
The copy number of pKF39ts5 is 1 per chromosome.
Drug concentration for chloramphenicol selection should be 8 to 10
microgramms per ml.
TOP10 but neither DH5alpha nor JM109 is advisable as a host strain
for alpha-complemetation selection.
The multiple cloning sites are as in pKF19c (Gene, 1994; 152,
271-275).
FEATURES Location/Qualifiers
source 1..3064
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(18..74)
/label=MCS
/note="pUC18/19 multiple cloning site"
primer_bind complement(75..91)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(537..1193)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(1194..1296)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
rep_origin 1637..1859
/label=pSC101 ori
/note="low-copy replication origin that requires the Rep101
protein"
CDS 1907..2854
/codon_start=1
/label=Rep101
/note="RepA protein needed for replication with the pSC101
origin"
/translation="MSELVVFKANELTISRYDLTEHETKLILCCVALLNPTIENPTRKE
RTVSFTYNQYAQMMNISRENAYGVLAKATRELMTRTVEIRNPLVKGFEIFQWTNYAKFS
SEKLELVFSEEILPYLFQLKKFIKYNLEHVKSFENKYSMRIYEWLLKELTQKKTHKANI
EISLDEFKFMLMLENNYHEFKRLNQWVLKPISKDLNTYSNMKLVVDKRGRPTDTLIFQV
ELDRQMDLVTELENNQIKMNGDKIPTTITSDSYLHNGLRKTLHDALTAKIQLTSFEAKF
LSDMQSKYDLNGSFSWLTQKQRTTLENILAKYGRI"
protein_bind 2956..2977
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 2992..3022
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 3030..3046
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.