Basic Vector Information
- Vector Name:
- pSV71BlaMG2f
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10377 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pSV71BlaMG2f vector Map
pSV71BlaMG2f vector Sequence
LOCUS V002929 10377 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V002929
VERSION V002929
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 10377)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 10377)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 10377)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10377)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10377
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 82..439
/label="SV40 promoter"
/note="SV40 enhancer and early promoter"
CDS 453..974
/label="small t antigen"
/note="SV40 (simian virus 40) small t antigen"
intron 979..1044
/label="small t intron"
/note="SV40 (simian virus 40) small t antigen intron"
CDS 1174..1194
/label="SV40 NLS"
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
polyA_signal 2948..3082
/label="SV40 poly(A) signal"
/note="SV40 polyadenylation signal"
misc_feature complement(3104..3194)
/label="3' UTR of mIgG2b"
/note="3' UTR of mIgG2b"
CDS complement(3195..3914)
/codon_start=1
/note="unnamed protein product; mIgG2b; fragment of heavy
chain of mouse anti-hPLAP monoclonal antibody (MG2)"
/protein_id="SJL88222.1"
/translation="ELSGPTSTINPCPPCKECHKCPAPNLEGGPSVFIFPPNIKDVLMI
SLTPKVTCVVVDVSEDDPDVQISWFVNNVEVLTAQTQTHREDYNSTIRVVSALPIQHQD
WMSGKEFKCKVNNKDLPAPIERTISKIKGIVRAPQVYILSPPPEQLSRKDVSLTCLAVG
FSPEDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDSFSCNVRHE
GLKNYYLKKTISRSPGK"
CDS complement(3915..4772)
/label="AmpR"
/note="beta-lactamase"
misc_feature complement(4886..5823)
/label="intron"
/note="intron"
CDS complement(5830..6015)
/note="Agnoprotein from Simian virus 40. Accession#:
P03084"
/label="Agnoprotein"
promoter 6087..6416
/label="SV40 promoter"
/note="SV40 enhancer and early promoter"
CDS 6430..6951
/label="small t antigen"
/note="SV40 (simian virus 40) small t antigen"
CDS 7151..7171
/label="SV40 NLS"
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
misc_feature 8226..8366
/label="bom"
/note="basis of mobility region from pBR322"
rep_origin complement(8552..9140)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(9485..10141)
/label="CmR"
/note="chloramphenicol acetyltransferase"
promoter complement(10142..10244)
/label="cat promoter"
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
This page is informational only.