Basic Vector Information
- Vector Name:
- PSM2
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6504 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Rahnama M, Forester N, Ariyawansa S, Voisey CR, Johnson LJ, Johnson RD, Fleetwood DJ.
PSM2 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
PSM2 vector Sequence
LOCUS 40924_40707 6504 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector PSM2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6504) AUTHORS Rahnama M, Forester N, Ariyawansa S, Voisey CR, Johnson LJ, Johnson RD, Fleetwood DJ. TITLE Efficient targeted mutagenesis in Epichloe festucae using a split marker system JOURNAL Unpublished REFERENCE 2 (bases 1 to 6504) AUTHORS Rahnama M, Fleetwood D. TITLE Direct Submission JOURNAL Submitted (27-SEP-2016) School of Biological Sciences, University of Auckland, 3A Symonds Street, Auckland, Auckland 1010, New Zealand REFERENCE 3 (bases 1 to 6504) TITLE Direct Submission REFERENCE 4 (bases 1 to 6504) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-SEP-2016) School of Biological Sciences, University of Auckland, 3A Symonds Street, Auckland, Auckland 1010, New Zealand" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6504 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" CDS 513..1454 /codon_start=1 /gene="hph" /product="hygromycin B phosphotransferase" /label=hph /protein_id="APD72153.1" /translation="SEGEESRAFSFDVGGRGYVLRVNSCADGFYKDRYVYRHFASAALP IPEVLDIGEFSESLTYCISRRAQGVTLQDLPETELPAVLQPVAEAMDAIAAADLSQTSG FGPFGPQGIGQYTTWRDFICAIADPHVYHWQTVMDDTVSASVAQALDELMLWAEDCPEV RHLVHADFGSNNVLTDNGRITAVIDWSEAMFGDSQYEVANIFFWRPWLACMEQQTRYFE RRHPELAGSPRLRAYMLRIGLDQLYQSLVDGNFDDAAWAQGRCDAIVRSGAGTVGRTQI ARRSAAVWTDGCVEVLADSGNRRPSTRPRAKE" gene 513..1454 /gene="hph" /label=hph terminator 1472..2240 /label=trpC terminator /note="transcription terminator from the Aspergillus nidulans trpC gene (Punt et al., 1987)" primer_bind 2279..2295 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind 2312..2543 /label=attP1 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" CDS complement(2942..3244) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(3592..4248) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(4249..4351) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind complement(4496..4727) /label=attP2 /note="recombination site for the Gateway(R) BP reaction (pDONR(TM)221 version)" promoter complement(4746..4764) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(4769..4785) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 4898..5704 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 5854..6442 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.