Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V004184 | pP43NMK | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
- Vector Name:
- pP43NMK
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7680 bp
- Type:
- Shuttle expression-secretion vector
- Replication origin:
- ori
- Source/Author:
- Zhang XZ, Cui ZL, Hong Q, Li SP.
pP43NMK vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pP43NMK vector Sequence
LOCUS 40924_34022 7680 bp DNA circular SYN 18-DEC-2018
DEFINITION Shuttle expression-secretion vector pP43NMK, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7680)
AUTHORS Zhang XZ, Cui ZL, Hong Q, Li SP.
TITLE High-level expression and secretion of methyl parathion hydrolase in
Bacillus subtilis WB800
JOURNAL Appl. Environ. Microbiol. 71 (7), 4101-4103 (2005)
PUBMED 16000826
REFERENCE 2 (bases 1 to 7680)
AUTHORS Zhang X-Z., Cui Z-L., Li S-P.
TITLE Direct Submission
JOURNAL Submitted (25-OCT-2005) Department of Microbiology, College of Life
Sciences, Nanjing Agricultural University, MOA Key Lab of
Microbiological Engineering of Agricultural Environment, #6 Tongwei
Road, Weigang, Nanjing, Jiangsu 210095, P. R. China
REFERENCE 3 (bases 1 to 7680)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7680)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "2005"; volume: "71"; issue: "7"; pages:
"4101-4103"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(25-OCT-2005) Department of Microbiology, College of Life Sciences,
Nanjing Agricultural University, MOA Key Lab of Microbiological
Engineering of Agricultural Environment, #6 Tongwei Road, Weigang,
Nanjing, Jiangsu 210095, P. R. China"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7680
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
CDS 814..1815
/label=repB
/note="RepB replication protein"
CDS 1987..2748
/codon_start=1
/gene="km"
/product="Km"
/label=km
/protein_id="ABD24446.1"
/translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD
GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF
SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP
SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK
LLESLENFWNGIQEWTERHGYIVDVSKRIPF"
gene 1987..2748
/gene="km"
/label=km
CDS 2965..3216
/codon_start=1
/gene="ble"
/product="Ble"
/label=ble
/protein_id="ABD24447.1"
/translation="MRMLQSIPALPVGDIKKSIGFYWDKVGFTLVHHEDGFAVLMCNEV
RIHLWEASDEGWRLVVMIHRFVQVRSRLLLVLLVAALK"
gene 2965..3216
/gene="ble"
/label=ble
regulatory 4367..4384
/note="-35 and -10 signal of promoter controlled by sigma
B"
/regulatory_class="minus_35_signal"
regulatory 4386..4391
/note="-35 and -10 signal of promoter controlled by sigma
A"
/regulatory_class="minus_35_signal"
regulatory 4400..4409
/note="-35 and -10 signal of promoter controlled by sigma
B"
/regulatory_class="minus_10_signal"
regulatory 4409..4414
/note="-35 and -10 signal of promoter controlled by sigma
A"
/regulatory_class="minus_10_signal"
mRNA 4419..5434
/gene="mpd"
/product="MPH"
/label=mpd mRNA
gene 4419..5434
/gene="mpd"
/label=mpd
regulatory 4441..4450
/gene="mpd"
/regulatory_class="ribosome_binding_site"
CDS 4460..5434
/codon_start=1
/gene="mpd"
/product="MPH"
/label=mpd
/note="methyl parathion hydrolase; includes NprB signal
peptide"
/protein_id="ABD24448.1"
/translation="MRNLTKTSLLLAGLCTAAQMVFVTHASAAAPQVRTSAPGYYRMLL
GDFEITALSDGTVALPVDKRLNQPAPKTQSALAKSFQKAPLETSVTGYLVNTGSKLVLV
DTGAAGLFGPTLGRLAANLKAAGYQPEQVDEIYITHMHPDHVGGLMVGEQLAFPNAVVR
ADQKEADFWLSQTNLDKAPDDESKGFFKGAMASLNPYVKAGKFKPFSGNTDLVPGIKAL
ASHGHTPGHTTYVVESQGQKLALLGDLILVAAVQFDDPSVTNQLDIDGKSAAVERKKAF
ADAAKGGYLIAASHLPFPGIGHIRAEGKGYRFVPVNYSVVNPK"
sig_peptide 4460..4546
/gene="mpd"
/note="from NprB"
primer_bind complement(5459..5475)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(5483..5499)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(5507..5537)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(5552..5573)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5861..6449)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(6623..7480)
/label=AmpR
/note="beta-lactamase"
promoter complement(7481..7585)
/label=AmpR promoter