Basic Vector Information
- Vector Name:
- pP02218-nat-cel8A
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6904 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P.
pP02218-nat-cel8A vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pP02218-nat-cel8A vector Sequence
LOCUS 40924_33987 6904 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pP02218-nat-cel8A, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6904) AUTHORS Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P. TITLE Efficient secretory heterologous enzyme production in the novel host Paenibacillus polymyxa by usage of its promoter sequences JOURNAL Unpublished REFERENCE 2 (bases 1 to 6904) AUTHORS Heinze S, Zimmermann K, Ludwig C, Heinzlmeir S, Schwarz WH, Zverlov VV, Liebl W, Kornberger P. TITLE Direct Submission JOURNAL Submitted (09-MAY-2018) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany REFERENCE 3 (bases 1 to 6904) TITLE Direct Submission REFERENCE 4 (bases 1 to 6904) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (09-MAY-2018) Department for Microbiology, Technical University of Munich, Emil-Ramann-Str. 4, Freising, Bavaria 85354, Germany" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..6904 /mol_type="other DNA" /organism="synthetic DNA construct" rep_origin complement(79..667) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(841..1698) /label=AmpR /note="beta-lactamase" promoter complement(1699..1803) /label=AmpR promoter CDS complement(1832..2116) /codon_start=1 /gene="traJ" /product="TraJ" /label=traJ /protein_id="AXF54530.1" /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV GQGYKITGVVDYEHVRELARINGDLGQQKAHYVNHHPNQVFWGRGAVKH" gene complement(1832..2116) /gene="traJ" /label=traJ oriT complement(2149..2258) /direction=LEFT /label=oriT /note="incP origin of transfer" CDS complement(2515..3276) /codon_start=1 /gene="kanR" /product="KanR" /label=kanR /note="Kanamycin Resistance" /protein_id="AXF54531.1" /translation="MNGPIIMTREERMKIVHEIKERILDKYGDDVKAIGVYGSLGRQTD GPYSDIEMMCVMSTEEAEFSHEWTTGEWKVEVNFDSEEILLDYASQVESDWPLTHGQFF SILPIYDSGGYLEKVYQTAKSVEAQTFHDAICALIVEELFEYAGKWRNIRVQGPTTFLP SLTVQVAMAGAMLIGLHHRICYTTSASVLTEAVKQSDLPSGYDHLCQFVMSGQLSDSEK LLESLENFWNGIQEWTERHGYIVDVSKRIPF" gene complement(2515..3276) /gene="kanR" /label=kanR CDS complement(3448..4449) /label=repB /note="RepB replication protein" regulatory 4866..5277 /label=P02218 promoter from P. polymyxa DSM292 /note="P02218 promoter from P. polymyxa DSM292" /regulatory_class="promoter" CDS 5308..6717 /gene="celA" /label=celA /note="Endoglucanase A from Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372). Accession#: A3DC29" CDS 6724..6741 /label=6xHis /note="6xHis affinity tag"
This page is informational only.