Basic Vector Information
- Vector Name:
- pOSCAR
- Antibiotic Resistance:
- Streptomycin
- Length:
- 9422 bp
- Type:
- Binary vector
- Replication origin:
- ori
- Source/Author:
- Paz Z, Garcia-Pedrajas MD, Andrews DL, Klosterman SJ, Baeza-Montanez L, Gold SE.
pOSCAR vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOSCAR vector Sequence
LOCUS 40924_33877 9422 bp DNA circular SYN 18-DEC-2018 DEFINITION Binary vector pOSCAR, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 9422) AUTHORS Paz Z, Garcia-Pedrajas MD, Andrews DL, Klosterman SJ, Baeza-Montanez L, Gold SE. TITLE One Step Construction of Agrobacterium-Recombination-ready-plasmids (OSCAR), an efficient and robust tool for ATMT based gene deletion construction in fungi JOURNAL Fungal Genet. Biol. 48 (7), 677-684 (2011) PUBMED 21362493 REFERENCE 2 (bases 1 to 9422) AUTHORS Paz Z, Garcia-Pedrajas MD, Andrews DL, Klosterman SJ, Baeza-Montanez L, Gold SE. TITLE Direct Submission JOURNAL Submitted (01-JUL-2010) Plant Pathology, The University of Georgia, 2105 Miller Plant Sci Bldg, Athens, GA 30602-7274, USA REFERENCE 3 (bases 1 to 9422) TITLE Direct Submission REFERENCE 4 (bases 1 to 9422) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Fungal Genet. Biol."; date: "2011"; volume: "48"; issue: "7"; pages: "677-684" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (01-JUL-2010) Plant Pathology, The University of Georgia, 2105 Miller Plant Sci Bldg, Athens, GA 30602-7274, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..9422 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1742..1766) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" primer_bind 1829..1845 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" promoter 1850..1868 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 1906..2137 /label=attP3 /note="recombination site for the Gateway(R) BP reaction" CDS complement(2497..2799) /codon_start=1 /label=ccdB /note="CcdB, a bacterial toxin that poisons DNA gyrase" /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI" CDS complement(3144..3800) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(3801..3903) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" protein_bind 4061..4292 /label=attP2 /note="recombination site for the Gateway(R) BP reaction" primer_bind complement(4330..4346) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" misc_feature complement(4629..4653) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 5181..5969 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 6216..6804 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(6990..7130) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(7474..7668) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(7737..8801) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" CDS complement(join(9238..9422,1..442)) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRNGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.