Basic Vector Information
- Vector Name:
- pOPT-GST_tjp1aC
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3590 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Fadeev A, Irion U, Nuesslein-Volhard C, Krauss J, Frohnhoefer HG.
pOPT-GST_tjp1aC vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOPT-GST_tjp1aC vector Sequence
LOCUS 40924_33807 3590 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pOPT-GST_tjp1aC, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3590) AUTHORS Fadeev A, Irion U, Nuesslein-Volhard C, Krauss J, Frohnhoefer HG. TITLE Direct Submission JOURNAL Submitted (06-APR-2015) Arbeitsgruppe Nuesslein-Volhard, Max Planck Institute for Developmental Biology, Spemannstrasse 35, Tuebingen, Germany 72076, Germany REFERENCE 2 (bases 1 to 3590) TITLE Direct Submission REFERENCE 3 (bases 1 to 3590) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (06-APR-2015) Arbeitsgruppe Nuesslein-Volhard, Max Planck Institute for Developmental Biology, Spemannstrasse 35, Tuebingen, Germany 72076, Germany" COMMENT SGRef: number: 2; type: "Journal Article" FEATURES Location/Qualifiers source 1..3590 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(262..1074) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 1196..1784 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(1970..2109) /label=bom /note="basis of mobility region from pBR322" promoter 2270..2288 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" RBS 2362..2384 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 2395..3048 /codon_start=1 /label=GST /note="glutathione S-transferase from Schistosoma japonicum" /translation="MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKK FELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRY GVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVL YMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK" CDS 3067..3087 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQG" misc_feature 3097..3408 /label=Region: tjp1a /note="Region: tjp1a" terminator 3512..3559 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase"
This page is informational only.