pOJ260 vector (V004238)

MSDS

Basic Vector Information

Vector Name:: pOJ260

Antibiotic Resistance:: Apramycin

Length:: 3469 bp

Type:: Cloning vector

Replication origin:: ori

Source/Author:: Liu G, Ou HY, Wang T, Li L, Tan H, Zhou X, Rajakumar K, Deng Z, He X.

pOJ260 vector Vector Map

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pOJ260 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_33737        3469 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pOJ260, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3469)
  AUTHORS   Liu G, Ou HY, Wang T, Li L, Tan H, Zhou X, Rajakumar K, Deng Z, He 
            X.
  TITLE     Cleavage of phosphorothioated DNA and methylated DNA by the type IV 
            restriction endonuclease ScoMcrA
  JOURNAL   PLoS Genet. 6 (12), E1001253 (2010)
  PUBMED    21203499
REFERENCE   2  (bases 1 to 3469)
  AUTHORS   Liu G, He XY, Deng ZX.
  TITLE     Direct Submission
  JOURNAL   
REFERENCE   3  (bases 1 to 3469)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3469)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS 
            Genet."; date: "2010"; volume: "6"; issue: "12"; pages: "E1001253"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (04-DEC-2009) School of Life Science "
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3469
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     423..439
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(508..524)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(532..548)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(556..586)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(601..622)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(910..1498)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             1702..2502
                     /codon_start=1
                     /label=ApmR
                     /note="aminoglycoside 3-N-acetyltransferase type IV"
                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"
     oriT            2947..3056
                     /label=oriT
                     /note="incP origin of transfer"

This page is informational only.