pOJ260 vector (V004238) Gene synthesis in pOJ260 backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V004238 pOJ260 In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pOJ260
Antibiotic Resistance:
Apramycin
Length:
3469 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Liu G, Ou HY, Wang T, Li L, Tan H, Zhou X, Rajakumar K, Deng Z, He X.
Growth Strain(s):
DH10B
Growth Temperature:
37℃

pOJ260 vector Map

pOJ2603469 bp6001200180024003000M13 fwdM13 revlac operatorlac promoterCAP binding siteoriApmRoriT

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Wang J, Zhu H, Shang H, Guo B, Zhang M, Wang F, Zhang L, Xu J, Wang H. Development of a thiostrepton-free system for stable production of PLD in Streptomyces lividans SBT5. Microb Cell Fact. 2022 Dec 19;21(1):263. doi: 10.1186/s12934-022-01992-1. PMID: 36529749; PMCID: PMC9761944.

pOJ260 vector Sequence

LOCUS       Exported                3469 bp DNA     circular SYN 15-JUL-2025
DEFINITION  Cloning vector pOJ260, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3469)
  AUTHORS   Liu G, Ou HY, Wang T, Li L, Tan H, Zhou X, Rajakumar K, Deng Z, He 
            X.
  TITLE     Cleavage of phosphorothioated DNA and methylated DNA by the type IV 
            restriction endonuclease ScoMcrA
  JOURNAL   PLoS Genet. 6 (12), E1001253 (2010)
  PUBMED    21203499
REFERENCE   2  (bases 1 to 3469)
  AUTHORS   Liu G, He XY, Deng ZX.
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 3469)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3469)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 3469)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS
            Genet."; date: "2010"; volume: "6"; issue: "12"; pages: "E1001253"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (04-DEC-2009) School of Life Science "
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3469
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     423..439
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(508..524)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(532..548)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(556..586)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(601..622)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(910..1498)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             1702..2502
                     /codon_start=1
                     /label=ApmR
                     /note="aminoglycoside 3-N-acetyltransferase type IV"
                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"
     oriT            2947..3056
                     /label=oriT
                     /note="incP origin of transfer"