Basic Vector Information
- Vector Name:
- pOEUra
- Antibiotic Resistance:
- Streptomycin
- Length:
- 11078 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Chen L.
pOEUra vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pOEUra vector Sequence
LOCUS 40924_33722 11078 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pOEUra, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11078) AUTHORS Chen L. TITLE Expression system for Pestalotiopsis microspora JOURNAL Unpublished REFERENCE 2 (bases 1 to 11078) AUTHORS Chen L. TITLE Direct Submission JOURNAL Submitted (19-FEB-2016) State Key Program of Microbiology and Department of Microbiology, College of Life Sciences, Nankai University, No. 94 Weijin Road, Tianjin 300071, China REFERENCE 3 (bases 1 to 11078) TITLE Direct Submission REFERENCE 4 (bases 1 to 11078) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (19-FEB-2016) State Key Program of Microbiology and Department of Microbiology, College of Life Sciences, Nankai University, No. 94 Weijin Road, Tianjin 300071, China" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..11078 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature complement(1742..1766) /label=RB T-DNA repeat /note="right border repeat from nopaline C58 T-DNA" promoter 1850..1868 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" misc_feature complement(6285..6309) /label=LB T-DNA repeat /note="left border repeat from nopaline C58 T-DNA" CDS 6837..7625 /codon_start=1 /label=SmR /note="aminoglycoside adenylyltransferase (Murphy, 1985)" /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK" rep_origin 7872..8460 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(8646..8786) /label=bom /note="basis of mobility region from pBR322" rep_origin complement(9130..9324) /direction=LEFT /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" CDS complement(9393..10457) /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV MRYRNLIEGEASAGS" CDS complement(join(10894..11078,1..442)) /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWASADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRNGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
This page is informational only.