pNT562 vector (V004268)

LOCUS       40924_33547        5058 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pNT562 DNA, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5058)
  AUTHORS   Nishida T, Watanabe K, Tachibana M, Shimizu T, Watarai M.
  TITLE     Characterization of the cryptic plasmid pOfk55 from Legionella 
            pneumophila and construction of a pOfk55-derived shuttle vector
  JOURNAL   Plasmid 90, 30-37 (2017)
  PUBMED    28259635
REFERENCE   2  (bases 1 to 5058)
  AUTHORS   Nishida T, Watanabe K, Tachibana M, Shimizu T, Watarai M.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-2017) Contact:Takashi Nishida Yamaguchi 
            University, The United Graduate School of Veterinary Science; 1677-1
            Yoshida, Yamaguchi, Yamaguchi 753-8515, Japan
REFERENCE   3  (bases 1 to 5058)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5058)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid 90,
            30-37 (2017)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (06-FEB-2017) Contact:Takashi Nishida Yamaguchi University, The 
            United Graduate School of Veterinary Science; 1677-1 Yoshida, 
            Yamaguchi, Yamaguchi 753-8515, Japan"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5058
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      563..572
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             1016..1603
                     /codon_start=1
                     /product="putative replication protein"
                     /label=putative replication protein
                     /protein_id="BAX01899.1"
                     /translation="MKKEPIPGKRKNVLAYPENPFWQKTEIKIGSKMVKVSGGKHINIE
                     GESISHSGIHVVKEIDENEFVKIYTKNIKAIFDLKPTAQRVLQYLITELQKTPNADAVY
                     LAWVGAEEYFSENHIKSSRASFHRALSELIQKGFLAESTKPNMFWFNPNLFFNGNRLTF
                     IHEYRKKTIQEIGKEENLVQSDIDKQIQIIFN"
     CDS             complement(1678..2757)
                     /label=lacI
                     /note="lac repressor"
     promoter        complement(2758..2833)
                     /label=lacIq promoter
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     promoter        3067..3095
                     /label=tac promoter
                     /note="strong E. coli promoter; hybrid between the trp and
                     lac UV5 promoters"
     protein_bind    3103..3119
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     misc_feature    complement(3166..3273)
                     /label=MCS
                     /note="pBluescript multiple cloning site"
     CDS             3479..4270
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     rep_origin      4452..5040
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"