Basic Vector Information
- Vector Name:
- pNS2Trc
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3109 bp
- Type:
- Expression vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Gillaspie D, Perkins I, Larsen K, McCord A, Pangonis S, Sweger D, Seleem MN, Sriranganathan N, Anderson BE.
- Promoter:
- trc
pNS2Trc vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNS2Trc vector Sequence
LOCUS 40924_33512 3109 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pNS2Trc, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3109) AUTHORS Gillaspie D, Perkins I, Larsen K, McCord A, Pangonis S, Sweger D, Seleem MN, Sriranganathan N, Anderson BE. TITLE Plasmid-based system for high-level gene expression and antisense gene knockdown in Bartonella henselae JOURNAL Appl. Environ. Microbiol. 75 (16), 5434-5436 (2009) PUBMED 19542333 REFERENCE 2 (bases 1 to 3109) AUTHORS Seleem MN, Anderson B, Sriranganathan N. TITLE Improved Expression Vectors for Bartonella JOURNAL Unpublished REFERENCE 3 (bases 1 to 3109) AUTHORS Seleem MN, Anderson B, Sriranganathan N. TITLE Direct Submission JOURNAL Submitted (29-MAR-2008) ICTAS, Virginia Tech, 1410 Prices Fork Rd, Blacksburg, VA 24061, USA REFERENCE 4 (bases 1 to 3109) TITLE Direct Submission REFERENCE 5 (bases 1 to 3109) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2009"; volume: "75"; issue: "16"; pages: "5434-5436" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (29-MAR-2008) ICTAS, Virginia Tech, 1410 Prices Fork Rd, Blacksburg, VA 24061, USA" COMMENT SGRef: number: 4; type: "Journal Article" FEATURES Location/Qualifiers source 1..3109 /mol_type="other DNA" /organism="synthetic DNA construct" promoter 23..52 /label=trc promoter /note="strong E. coli promoter; hybrid between the trp and lac UV5 promoters" protein_bind 60..76 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." misc_feature 93..162 /label=rrnG antiterminator /note="antiterminator from the E. coli rrnG leader region (Berg et al., 1989)" CDS 213..236 /codon_start=1 /label=minicistron /note="synthetic cistron containing a ribosome binding site (Shine-Dalgarno sequence), for enhancing the bacterial expression of a downstream cistron (Schoner, 1997)" /translation="MYRLNKEE" CDS 246..263 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 595..1401 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDE" CDS complement(1457..2116) /codon_start=1 /label=pBBR1 Rep /note="replication protein for the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica" /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR" rep_origin complement(2117..2886) /direction=LEFT /label=pBBR1 oriV /note="replication origin of the broad-host-range plasmid pBBR1 from Bordetella bronchiseptica; requires the pBBR1 Rep protein for replication"
This page is informational only.