Basic Vector Information
- Vector Name:
- pNR-46124
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7788 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP.
pNR-46124 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNR-46124 vector Sequence
LOCUS 40924_33482 7788 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pNR-46124, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7788) AUTHORS Charpentier E, Anton AI, Barry P, Alfonso B, Fang Y, Novick RP. TITLE Novel cassette-based shuttle vector system for gram-positive bacteria JOURNAL Appl. Environ. Microbiol. 70 (10), 6076-6085 (2004) PUBMED 15466553 REFERENCE 2 (bases 1 to 7788) AUTHORS Riojas MA, Bojja K, Hazbon MH. TITLE pNR-46124, A Shuttle Vector for Gram-Positive Bacteria JOURNAL Unpublished REFERENCE 3 (bases 1 to 7788) AUTHORS Riojas MA, Bojja K, Hazbon MH. TITLE Direct Submission JOURNAL Submitted (17-JUN-2014) Bacteriology, BEI Resources/American Type Culture Collection (ATCC), 10801 University Blvd., Manassas, VA 20110, USA REFERENCE 4 (bases 1 to 7788) TITLE Direct Submission REFERENCE 5 (bases 1 to 7788) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2004"; volume: "70"; issue: "10"; pages: "6076-6085" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted (17-JUN-2014) Bacteriology, BEI Resources/American Type Culture Collection (ATCC), 10801 University Blvd., Manassas, VA 20110, USA" COMMENT SGRef: number: 4; type: "Journal Article" COMMENT ##Assembly-Data-START## Assembly Method :: CLC Genomics Workbench v. 7.0.2 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..7788 /mol_type="other DNA" /organism="synthetic DNA construct" misc_feature 7..2589 /note="tetM; derived from M21136.1 S.aureus tetracycline resistance (tetM) gene" CDS 295..2229 /codon_start=1 /gene="tetM" /product="tetracycline resistance protein" /label=tetM /protein_id="AIL56505.1" /translation="MEENHMKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGT TRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLI SAKDGVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKV ELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLY HGSAKSNIGIDNLIEVITNKFYSSTHRGPSELCGNVFKIEYTKKRQRLAYIRLYSGVLH LRDSVRVSEKEKIKVTEMYTSINGELCKIDRAYSGEIVILQNEFLKLNSVLGDTKLLPQ RKKIENPHPLLQTTVEPSKPEQREMLLDALLEISDSDPLLRYYVDSTTHEIILSFLGKV QMEVISALLQEKYHVEIELKEPTVIYMERPLKNAEYTIHIEVPPNPFWASIGLSVSPLP LGSGMQYESSVSLGYLNQSFQNAVMEGIRYGCEQGLYGWNVTDCKICFKYGLYYSPVST PADFRMLTPIVLEQAFRKAGTELLEPYLSFKVYAPQEYLSRAYNDAPKYCANIVNTQLK NNEVIIIGEIPARCIQDYRNDLTFFTNGLSVCLAELKGYQVTTGEPVCQTRRLNSRIDK VRYMFNKIT" gene 295..2229 /gene="tetM" /label=tetM promoter 2853..2957 /label=AmpR promoter CDS 2958..3815 /label=AmpR /note="beta-lactamase" rep_origin 3989..4577 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" primer_bind complement(4759..4775) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS 5605..6549 /codon_start=1 /gene="repC" /product="replication initiation protein" /label=repC /protein_id="AIL56507.1" /translation="MYKNNHANHSNHLENHDLDNFSKTGYSNSRLDAHTVCISDPKLSF DAMTIVGNLNRDNAQALSKFMSVEPQIRLWDILQTKFKAKALQEKVYIEYDKVKADSWD RRNMRIEFNPNKLTRDEMIWLKQNIISYMEDDGFTRLDLAFDFEDDLSDYYAMSDKAVK KTIFYGRNGKPETKYFGVRDSNRFIRIYNKKQERKDNADAEVMSEHLWRVEIELKRDMV DYWNDCFSDLHILQPDWKTIQRTADRAIVFMLLSDEEEWGKLHRNSRTKYKNLIKEISP VDLTDLMKSTLKANEKQLQKQIDFWQHEFKFWK" gene 5605..6549 /gene="repC" /label=repC mobile_element complement(6982..7749) /label=IS1 /note="prokaryotic transposable element"
This page is informational only.