Basic Vector Information
- Vector Name:
- pNQ705-1
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4482 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Mou X, Spinard EJ, Driscoll MV, Zhao W, Nelson DR.
pNQ705-1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNQ705-1 vector Sequence
LOCUS 40924_33472 4482 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pNQ705-1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4482)
AUTHORS Mou X, Spinard EJ, Driscoll MV, Zhao W, Nelson DR.
TITLE H-NS Is a Negative Regulator of the Two Hemolysin/Cytotoxin Gene
Clusters in Vibrio anguillarum
JOURNAL Infect. Immun. 81 (10), 3566-3576 (2013)
PUBMED 23836825
REFERENCE 2 (bases 1 to 4482)
AUTHORS Mou X, Spinard EJ, Driscoll MV, Zhao W, Nelson DR.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2013) Cell and Molecular Biology, University of
Rhode Island, 120 Flagg Rd, Kingston, RI 02881, USA
REFERENCE 3 (bases 1 to 4482)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4482)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Infect.
Immun."; date: "2013"; volume: "81"; issue: "10"; pages: "3566-3576"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(19-MAR-2013) Cell and Molecular Biology, University of Rhode
Island, 120 Flagg Rd, Kingston, RI 02881, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..4482
/mol_type="other DNA"
/organism="synthetic DNA construct"
oriT 623..732
/label=oriT
/note="incP origin of transfer"
CDS 765..1133
/codon_start=1
/label=traJ
/note="oriT-recognizing protein"
/translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV
GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE
KQDELGKVMMGVVRPRAEP"
CDS 1192..1818
/codon_start=1
/product="conjugal transfer relaxase TraI"
/label=conjugal transfer relaxase TraI
/protein_id="AGO64132.1"
/translation="MRSIKKSDFAELVKYITDEQGKTERLGHVRVTNCEANTLPAVMAE
VMATQHGNTRSEADKTYHLLVSFRAGEKPDAETLRAIEDRICAGLGFAEHQRVSAVHHD
TDNLHIHIAINKIHPTRNTIHEPYRAYRALADLCATLERDYGLERDNHETRQRVSENRA
NDMERHAGVESLVGWIRPRCVRRRGSEDQQFNLLIVRTKLSCFTY"
rep_origin 1754..2142
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
protein_bind 2177..2193
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter 2574..2676
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 2677..3333
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
This page is informational only.