Basic Vector Information
- Vector Name:
- pNOV043
- Antibiotic Resistance:
- Gentamycin
- Length:
- 11403 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Wei J-R.
- Promoter:
- Pc
pNOV043 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNOV043 vector Sequence
LOCUS 40924_33427 11403 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector pNOV043, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 11403) AUTHORS Wei J-R. TITLE LpxK is essential for growth of Acinetobacter baumannii ATCC 19606: relationship to toxic accumulation of lipid A pathway intermediates JOURNAL Unpublished REFERENCE 2 (bases 1 to 11403) AUTHORS Wei J-R. TITLE Direct Submission JOURNAL Submitted (11-APR-2017) Infectious Diseases, Bacteriology, Novartis Institutes for Biomedical Research, 5300 Chiron Way, Emeryville, CA 94608, USA REFERENCE 3 (bases 1 to 11403) TITLE Direct Submission REFERENCE 4 (bases 1 to 11403) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (11-APR-2017) Infectious Diseases, Bacteriology, Novartis Institutes for Biomedical Research, 5300 Chiron Way, Emeryville, CA 94608, USA" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..11403 /mol_type="other DNA" /organism="synthetic DNA construct" regulatory 7..1337 /regulatory_class="replication_regulatory_region" regulatory 1430..1629 /regulatory_class="promoter" CDS 1630..2640 /codon_start=1 /gene="lpxK" /product="tetraacyldisaccharide 4'-kinase" /EC_number="2.7.1.130" /label=lpxK /note="LpxK; involved in lipid A biosynthesis" /protein_id="ASL05635.1" /translation="MSLAQLIQNAWNKQSSWLIVLRPLSCLYRAGFLLNRGFYSSGFKK VYTAPVPVMVIGNITVGGSGKTPLLIELVNYLKQHNVKVGVISRGYGGSGPFPMLVTSA SQAAEAGDEPALIVQSTGVPMAVGPNRQAAIELLLASTKLDLIISDDGLQHWALGRQIE WIVLDQNRGLGNRKLLPEGYLREPVERLKTSTVIEHTFTPTTTLHMHLDAGQPYLLNPS SATELSFNIQNNYHAVVGIGFPQRFYQTLKGLGVKQFQEHAFRDHHDYSIDDLLFNDDQ PIITTEKDAVKLLPLLEKHPEFKRPIWVVPVKAVLSTECYQVLNQQLQKLDIQIS" gene 1630..2640 /gene="lpxK" /label=lpxK promoter 8801..8829 /label=Pc promoter /note="class 1 integron promoter" CDS 9018..9548 /label=GmR /note="gentamycin acetyltransferase" rep_origin 9573..10000 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" rep_origin 10139..10727 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(10913..11053) /label=bom /note="basis of mobility region from pBR322"
This page is informational only.