pNOV043 vector (V004294)

LOCUS       40924_33427       11403 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pNOV043, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11403)
  AUTHORS   Wei J-R.
  TITLE     LpxK is essential for growth of Acinetobacter baumannii ATCC 19606: 
            relationship to toxic accumulation of lipid A pathway intermediates
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 11403)
  AUTHORS   Wei J-R.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-APR-2017) Infectious Diseases, Bacteriology, Novartis 
            Institutes for Biomedical Research, 5300 Chiron Way, Emeryville, CA 
            94608, USA
REFERENCE   3  (bases 1 to 11403)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 11403)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (11-APR-2017) Infectious Diseases, Bacteriology, Novartis Institutes
            for Biomedical Research, 5300 Chiron Way, Emeryville, CA 94608, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..11403
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      7..1337
                     /regulatory_class="replication_regulatory_region"
     regulatory      1430..1629
                     /regulatory_class="promoter"
     CDS             1630..2640
                     /codon_start=1
                     /gene="lpxK"
                     /product="tetraacyldisaccharide 4'-kinase"
                     /EC_number="2.7.1.130"
                     /label=lpxK
                     /note="LpxK; involved in lipid A biosynthesis"
                     /protein_id="ASL05635.1"
                     /translation="MSLAQLIQNAWNKQSSWLIVLRPLSCLYRAGFLLNRGFYSSGFKK
                     VYTAPVPVMVIGNITVGGSGKTPLLIELVNYLKQHNVKVGVISRGYGGSGPFPMLVTSA
                     SQAAEAGDEPALIVQSTGVPMAVGPNRQAAIELLLASTKLDLIISDDGLQHWALGRQIE
                     WIVLDQNRGLGNRKLLPEGYLREPVERLKTSTVIEHTFTPTTTLHMHLDAGQPYLLNPS
                     SATELSFNIQNNYHAVVGIGFPQRFYQTLKGLGVKQFQEHAFRDHHDYSIDDLLFNDDQ
                     PIITTEKDAVKLLPLLEKHPEFKRPIWVVPVKAVLSTECYQVLNQQLQKLDIQIS"
     gene            1630..2640
                     /gene="lpxK"
                     /label=lpxK
     promoter        8801..8829
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     CDS             9018..9548
                     /label=GmR
                     /note="gentamycin acetyltransferase"
     rep_origin      9573..10000
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     rep_origin      10139..10727
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(10913..11053)
                     /label=bom
                     /note="basis of mobility region from pBR322"