Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V004299 | pNL4-3 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
- Vector Name:
- pNL4-3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 14825 bp
- Type:
- HIV-1 vector
- Replication origin:
- ori
- Source/Author:
- Adachi A, Gendelman HE, Koenig S, Folks T, Willey R, Rabson A, Martin MA.
pNL4-3 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNL4-3 vector Sequence
LOCUS 40924_33397 14825 bp DNA circular SYN 18-DEC-2018
DEFINITION HIV-1 vector pNL4-3, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 14825)
AUTHORS Adachi A, Gendelman HE, Koenig S, Folks T, Willey R, Rabson A,
Martin MA.
TITLE Production of acquired immunodeficiency syndrome-associated
retrovirus in human and nonhuman cells transfected with an
infectious molecular clone
JOURNAL J. Virol. 59 (2), 284-291 (1986)
PUBMED 3016298
REFERENCE 2 (bases 1 to 14825)
AUTHORS Bosche WJ, Poon DTK., Ott DE, Hu W-S., Gorelick RJ.
TITLE Complete Plasmid Sequence of pNL4-3
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 14825)
AUTHORS Bosche WJ, Poon DTK., Ott DE, Hu W-S., Gorelick RJ.
TITLE Direct Submission
JOURNAL Submitted (28-NOV-2000) AIDS Vaccine Program, SAIC Frederick and
Drug Resistance Program, National Cancer Institute at Frederick, PO
Box B, Frederick, Maryland 21702-1202, USA
REFERENCE 4 (bases 1 to 14825)
AUTHORS Strebel KJ, Martin MA.
TITLE Direct Submission
JOURNAL Submitted (24-MAY-2010) NIAID, Viral Biochemistry, National
Institutes of Health, Bethesda, MD, USA
REFERENCE 5 (bases 1 to 14825)
TITLE Direct Submission
REFERENCE 6 (bases 1 to 14825)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Virol.";
date: "1986"; volume: "59"; issue: "2"; pages: "284-291"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(28-NOV-2000) AIDS Vaccine Program, SAIC Frederick and Drug
Resistance Program, National Cancer Institute at Frederick, PO Box
B, Frederick, Maryland 21702-1202, USA"
COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Submitted
(24-MAY-2010) NIAID, Viral Biochemistry, National Institutes of
Health, Bethesda, MD, USA"
COMMENT SGRef: number: 5; type: "Journal Article"
COMMENT On May 24, 2010 this sequence version replaced AF324493.1.
FEATURES Location/Qualifiers
source 1..14825
/mol_type="other DNA"
/organism="synthetic DNA construct"
repeat_region 1..634
/label=5' long terminal repeat
/note="5' long terminal repeat"
LTR 377..634
/label=5' LTR (truncated)
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
repeat_region 454..550
/note="R; 5' copy"
misc_feature 681..806
/label=HIV-1 Psi
/note="packaging signal of human immunodeficiency virus
type 1"
CDS 790..2289
/label=HIV-1 gag
/note="gag protein from human immunodeficiency virus 1"
CDS 2085..5093
/label=HIV-1 pol
/note="pol protein from human immunodeficiency virus 1"
CDS 5041..5616
/gene="vif"
/label=vif
/note="Virion infectivity factor from Human
immunodeficiency virus type 1 group M subtype B (isolate
NY5). Accession#: P12504"
CDS 5559..5849
/codon_start=1
/product="vpr protein"
/label=vpr protein
/protein_id="AAK08485.1"
/translation="MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHNLGQH
IYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS"
misc_feature 5743..5748
/label=EcoRI site of recombination
/note="EcoRI site of recombination"
CDS 5830..6003
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate BH5). Accession#: P04612"
CDS 6221..8779
/gene="env"
/label=env
/note="Envelope glycoprotein gp160 from Human
immunodeficiency virus type 1 group M subtype B (isolate
MFA). Accession#: P19551"
CDS 8787..8813
/gene="nef"
/label=nef
/note="Protein Nef from Human immunodeficiency virus type 1
group M subtype D (isolate Z84). Accession#: P12481"
LTR 9076..9709
/label=3' LTR
/note="3' long terminal repeat (LTR) from HIV-1"
misc_feature 9710..11283
/label=3' cellular genomic sequence
/note="3' cellular genomic sequence"
rep_origin complement(11520..12108)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(12282..13139)
/label=AmpR
/note="beta-lactamase"
promoter complement(13140..13244)
/label=AmpR promoter
misc_feature 13648..14825
/label=5' cellular genomic sequence
/note="5' cellular genomic sequence"