pNL4-3 vector (Cat. No.: V004299)
- Name:
- pNL4-3
- Antibiotic Resistance:
- Ampicillin
- Length:
- 14825 bp
- Type:
- HIV-1 vector
- Replication origin:
- ori
- Source/Author:
- Adachi A, Gendelman HE, Koenig S, Folks T, Willey R, Rabson A, Martin MA.
- Growth Strain(s):
- stbl3
- Growth Temperature:
- 37℃
Resources
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pNL4-3 vector (Cat. No.: V004299) Sequence
LOCUS V004299 14825 bp DNA circular SYN 18-DEC-2018
DEFINITION Exported.
ACCESSION V004299
VERSION V004299
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 14825)
AUTHORS Adachi A, Gendelman HE, Koenig S, Folks T, Willey R, Rabson A,
Martin MA.
TITLE Production of acquired immunodeficiency syndrome-associated
retrovirus in human and nonhuman cells transfected with an
infectious molecular clone
JOURNAL J. Virol. 59 (2), 284-291 (1986)
PUBMED 3016298
REFERENCE 2 (bases 1 to 14825)
AUTHORS Bosche WJ, Poon DTK., Ott DE, Hu W-S., Gorelick RJ.
TITLE Complete Plasmid Sequence of pNL4-3
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 14825)
AUTHORS Bosche WJ, Poon DTK., Ott DE, Hu W-S., Gorelick RJ.
TITLE Direct Submission
JOURNAL Submitted (28-NOV-2000) AIDS Vaccine Program, SAIC Frederick and
Drug Resistance Program, National Cancer Institute at Frederick, PO
Box B, Frederick, Maryland 21702-1202, USA
REFERENCE 4 (bases 1 to 14825)
AUTHORS Strebel KJ, Martin MA.
TITLE Direct Submission
JOURNAL Submitted (24-MAY-2010) NIAID, Viral Biochemistry, National
Institutes of Health, Bethesda, MD, USA
REFERENCE 5 (bases 1 to 14825)
TITLE Direct Submission
REFERENCE 6 (bases 1 to 14825)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "J. Virol.";
date: "1986"; volume: "59"; issue: "2"; pages: "284-291"
SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(28-NOV-2000) AIDS Vaccine Program, SAIC Frederick and Drug
Resistance Program, National Cancer Institute at Frederick, PO Box
B, Frederick, Maryland 21702-1202, USA"
SGRef: number: 4; type: "Journal Article"; journalName: "Submitted
(24-MAY-2010) NIAID, Viral Biochemistry, National Institutes of
Health, Bethesda, MD, USA"
SGRef: number: 5; type: "Journal Article"
On May 24, 2010 this sequence version replaced AF324493.1.
FEATURES Location/Qualifiers
source 1..14825
/mol_type="other DNA"
/organism="synthetic DNA construct"
repeat_region 1..634
/label="5' long terminal repeat"
/note="5' long terminal repeat"
LTR 377..634
/label="5' LTR (truncated)"
/note="truncated 5' long terminal repeat (LTR) from HIV-1"
repeat_region 454..550
/note="R; 5' copy"
misc_feature 681..806
/label="HIV-1 Psi"
/note="packaging signal of human immunodeficiency virus
type 1"
CDS 790..2289
/label="HIV-1 gag"
/note="gag protein from human immunodeficiency virus 1"
CDS 2085..5093
/label="HIV-1 pol"
/note="pol protein from human immunodeficiency virus 1"
CDS 5041..5616
/gene="vif"
/label="Virion infectivity factor"
/note="Virion infectivity factor from Human
immunodeficiency virus type 1 group M subtype B (isolate
NY5). Accession#: P12504"
CDS 5559..5849
/codon_start=1
/product="vpr protein"
/label="vpr protein"
/protein_id="AAK08485.1"
/translation="MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHNLGQH
IYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS"
misc_feature 5743..5748
/label="EcoRI site of recombination"
/note="EcoRI site of recombination"
CDS 5830..6003
/note="Protein Tat from Human immunodeficiency virus type 1
group M subtype B (isolate BH5). Accession#: P04612"
/label="Protein Tat"
CDS 6221..8779
/gene="env"
/label="Envelope glycoprotein gp160"
/note="Envelope glycoprotein gp160 from Human
immunodeficiency virus type 1 group M subtype B (isolate
MFA). Accession#: P19551"
CDS 8787..8813
/gene="nef"
/label="Protein Nef"
/note="Protein Nef from Human immunodeficiency virus type 1
group M subtype D (isolate Z84). Accession#: P12481"
LTR 9076..9709
/label="3' LTR"
/note="3' long terminal repeat (LTR) from HIV-1"
misc_feature 9710..11283
/label="3' cellular genomic sequence"
/note="3' cellular genomic sequence"
rep_origin complement(11520..12108)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(12282..13139)
/label="AmpR"
/note="beta-lactamase"
promoter complement(13140..13244)
/label="AmpR promoter"
misc_feature 13648..14825
/label="5' cellular genomic sequence"
/note="5' cellular genomic sequence"