Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V004308 | pNIT-1 | In stock (lyophilized plasmid) |
Buy one, get one free! |
Two vials of lyophilized plasmid will be delivered, each vial is about 5µg.
Basic Vector Information
- Vector Name:
- pNIT-1
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6207 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Pandey AK, Raman S, Proff R, Joshi S, Kang CM, Rubin EJ, Husson RN, Sassetti CM.
pNIT-1 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNIT-1 vector Sequence
LOCUS 40924_33292 6207 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector pNIT-1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6207)
AUTHORS Pandey AK, Raman S, Proff R, Joshi S, Kang CM, Rubin EJ, Husson RN,
Sassetti CM.
TITLE Nitrile-inducible gene expression in mycobacteria
JOURNAL Tuberculosis (Edinb) 89 (1), 12-16 (2009)
PUBMED 18801704
REFERENCE 2 (bases 1 to 6207)
AUTHORS Pandey AK, Proff R, Joshi S, Sassetti CM.
TITLE Direct Submission
JOURNAL Submitted (01-SEP-2008) Molecular Genetics and Microbiology,
University of Massachusetts Medical School, 55 Lake Avenue North.
S6-141, Worcester, MA 01655, USA
REFERENCE 3 (bases 1 to 6207)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6207)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Tuberculosis (Edinb)"; date: "2009"; volume: "89"; issue: "1";
pages: "12-16"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(01-SEP-2008) Molecular Genetics and Microbiology, University of
Massachusetts Medical School, 55 Lake Avenue North. S6-141,
Worcester, MA 01655, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6207
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 141..953
/label=KanR
/note="aminoglycoside phosphotransferase"
rep_origin 1288..1876
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
rep_origin 2035..3930
/label=pAL5000 mycobacterial origin of replication
/note="pAL5000 mycobacterial origin of replication"
terminator complement(3974..4021)
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
regulatory 4059..4173
/label=PnitA
/note="PnitA"
/regulatory_class="promoter"
misc_feature 4174..4222
/label=multiple cloning site
/note="multiple cloning site"
terminator 4229..4268
/label=fd terminator
/note="central terminator from bacteriophage fd (Otsuka and
Kunisawa, 1982)"
regulatory 4276..4390
/label=PnitA
/note="PnitA"
/regulatory_class="promoter"
CDS 4391..5350
/codon_start=1
/gene="nitR"
/product="nitrile-inducible regulatory protein"
/label=nitR
/protein_id="ACI22356.1"
/translation="MNTFFSSDQVSAPDRVALWHDVICRSYVPLNITLTSEQPFIGTVS
TGNLGTVRIATSSSLPQQITRTRRLIRQDEREYLMVGVQSAGHALVQQHGRTARVGRGG
LVFWDTRHPYDILFPTDWRMSVFQFPRYSFGFTEDFIGRMTAVNVGGDRGIGRVVSSFM
TSINDATDAGDLAEVASLHNSAVDLLSAAIRTELADQAAASDGLLECVLAYIRQNLADP
NLCASQIAAEHNVSVRTLHRLFSATGQGVAEHIRNLRLERIKTELADPTSRRYTISALA
RKWGFLDPSTFSRAFKDAYGITAREWAASASASPTEVS"
gene 4391..5350
/gene="nitR"
/label=nitR
terminator complement(5388..5415)
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
terminator complement(5507..5593)
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"