Basic Vector Information
- Vector Name:
- pNIC6010
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8253 bp
- Type:
- Shuttle vector
- Replication origin:
- p15A ori
- Source/Author:
- Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D.
pNIC6010 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNIC6010 vector Sequence
LOCUS 40924_33257 8253 bp DNA circular SYN 18-DEC-2018 DEFINITION Shuttle vector pNIC6010 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 8253) AUTHORS Heeb S, Itoh Y, Nishijyo T, Schnider U, Keel C, Wade J, Walsh U, O'Gara F, Haas D. TITLE Small, stable shuttle vectors based on the minimal pVS1 replicon for use in gram-negative, plant-associated bacteria JOURNAL Mol. Plant Microbe Interact. 13 (2), 232-237 (2000) PUBMED 10659714 REFERENCE 2 (bases 1 to 8253) AUTHORS Itoh Y, Nishijyo T. TITLE Direct Submission JOURNAL Submitted (23-MAY-2000) Yoshifumi Itoh, National Food Research Institute, Division of Applied Microbiology; kannondai 2-1-2, Tsukuba, Ibaraki 305-8642, Japan (E-mail:yosifumi@nfri.affrc.go.jp, Tel:81-298-38-8075, Fax:81-298-38-7997) REFERENCE 3 (bases 1 to 8253) TITLE Direct Submission REFERENCE 4 (bases 1 to 8253) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Mol. Plant Microbe Interact."; date: "2000"; volume: "13"; issue: "2"; pages: "232-237" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (23-MAY-2000) Yoshifumi Itoh, National Food Research Institute, Division of Applied Microbiology"; volume: " kannondai 2-1-2, Tsukuba, Ibaraki 305-8642, Japan (E-mail:yosifumi@nfri.affrc.go.jp, Tel:81-298-38-8075, Fax"; pages: "81-298-38-7997" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..8253 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 195..881 /codon_start=1 /product="pVS1 resolvase" /label=pVS1 resolvase /note="not required for stable maintenance; orf1" /protein_id="BAA96311.1" /translation="MNKSAAAGLLGYARVSTDDQDLTNQRAELHAAGCTKLFSEKITGT RRDRPELARMLDHLRPGDVVTVTRLDRLARSTRDLLDIAERIQEAGAGLRSLAEPWADT TTPAGRMVLTVFAGIAEFERSLIIDRTRSGREAAKARGVKFGPRPTLTPAQIAHARELI DQEGRTVKEAAALLGVHRSTLYRALERSEEVTPTEARRRGAFREDALTEADALAAAENE RQEEQA" CDS 878..1093 /codon_start=1 /product="hypothetical protein" /label=hypothetical protein /note="not required for stable maintenance; orf2" /protein_id="BAA96312.1" /translation="MKPHQDGQDEPFFITEEIEAEMIAAGYVFEPPAHVSTVRLHEILA GLSDAKLAAWPASLAAEETERRRLKR" CDS 1180..1806 /codon_start=1 /label=pVS1 StaA /note="stability protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI" CDS 1830..2045 /codon_start=1 /product="hypothetical protein" /function="unknown" /label=hypothetical protein /note="not required for stable maintenance; orf3" /protein_id="BAA96314.1" /translation="MSKSTNTLSAGRPSARSSKAATLASLADTPAMKRVNFQLPAEDHT KLKMYAVRQGKTITELLSEYIAQLPE" misc_feature 2076..2088 /label=KroB box /note="KroB box" CDS 2238..3308 /codon_start=1 /label=pVS1 RepA /note="replication protein from the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" /translation="VSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI LVMRYRNLIEGEASAGS" rep_origin 3377..3571 /label=pVS1 oriV /note="origin of replication for the Pseudomonas plasmid pVS1 (Heeb et al., 2000)" rep_origin 4281..4826 /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." misc_feature 5068..5089 /label=p15A origin of transfer /note="p15A origin of transfer" misc_feature 5450..5502 /label=multi cloning site /note="multi cloning site" CDS complement(6673..7530) /codon_start=1 /label=AmpR /note="beta-lactamase" /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDKLGARVGYI ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS LIKHW" promoter complement(7531..7635) /label=AmpR promoter oriT 8128..8237 /label=oriT /note="incP origin of transfer"
This page is informational only.