Basic Vector Information
- Vector Name:
- pNIC-Bio3 plasmid pNIC-Bio3
- Antibiotic Resistance:
- Kanamycin
- Length:
- 7335 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Keates T, Cooper CD, Savitsky P, Allerston CK, Phillips C, Hammarstrom M, Daga N, Berridge G, Mahajan P, Burgess-Brown NA, Muller S, Graslund S, Gileadi O.
- Promoter:
- sacB
pNIC-Bio3 plasmid pNIC-Bio3 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pNIC-Bio3 plasmid pNIC-Bio3 vector Sequence
LOCUS 40924_33212 7335 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pNIC-Bio3 plasmid pNIC-Bio3, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7335) AUTHORS Keates T, Cooper CD, Savitsky P, Allerston CK, Phillips C, Hammarstrom M, Daga N, Berridge G, Mahajan P, Burgess-Brown NA, Muller S, Graslund S, Gileadi O. TITLE Expressing the human proteome for affinity proteomics: optimising expression of soluble protein domains and in vivo biotinylation JOURNAL N Biotechnol 29 (5), 515-525 (2012) PUBMED 22027370 REFERENCE 2 (bases 1 to 7335) AUTHORS Burgess-Brown NA, Gileadi O. TITLE Direct Submission JOURNAL Submitted (27-SEP-2011) Structural Genomics Consortium, SGC, University of Oxford, ORCRB, Roosevelt Drive, Oxford OX3 7DQ, UK REFERENCE 3 (bases 1 to 7335) TITLE Direct Submission REFERENCE 4 (bases 1 to 7335) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "N Biotechnol"; date: "2012"; volume: "29"; issue: "5"; pages: "515-525" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (27-SEP-2011) Structural Genomics Consortium, SGC, University of Oxford, ORCRB, Roosevelt Drive, Oxford OX3 7DQ, UK" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..7335 /mol_type="other DNA" /organism="synthetic DNA construct" RBS 12..34 /label=RBS /note="efficient ribosome binding site from bacteriophage T7 gene 10 (Olins and Rangwala, 1989)" CDS 45..62 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" CDS 87..107 /codon_start=1 /label=TEV site /note="tobacco etch virus (TEV) protease recognition and cleavage site" /translation="ENLYFQS" promoter 123..568 /label=sacB promoter /note="sacB promoter and control region" CDS 569..1987 /codon_start=1 /label=SacB /note="secreted levansucrase that renders bacterial growth sensitive to sucrose" /translation="MNIKKFAKQATVLTFTTALLAGGATQAFAKETNQKPYKETYGISH ITRHDMLQIPEQQKNEKYQVPEFDSSTIKNISSAKGLDVWDSWPLQNADGTVANYHGYH IVFALAGDPKNADDTSIYMFYQKVGETSIDSWKNAGRVFKDSDKFDANDSILKDQTQEW SGSATFTSDGKIRLFYTDFSGKHYGKQTLTTAQVNVSASDSSLNINGVEDYKSIFDGDG KTYQNVQQFIDEGNYSSGDNHTLRDPHYVEDKGHKYLVFEANTGTEDGYQGEESLFNKA YYGKSTSFFRQESQKLLQSDKKRTAELANGALGMIELNDDYTLKKVMKPLIASNTVTDE IERANVFKMNGKWYLFTDSRGSKMTIDGITSNDIYMLGYVSNSLTGPYKPLNKTGLVLK MDLDPNDVTFTYSHFAVPQAKGNNVVITSYMTNRGFYADKQSTFAPSFLLNIKGKKTSV VKDSILEQGQLTVNK" CDS 2052..2096 /codon_start=1 /label=AviTag(TM) /note="peptide tag that allows for enzymatic biotinylation" /translation="GLNDIFEAQKIEWHE" CDS 2149..2166 /codon_start=1 /label=6xHis /note="6xHis affinity tag" /translation="HHHHHH" terminator 2233..2280 /label=T7 terminator /note="transcription terminator for bacteriophage T7 RNA polymerase" rep_origin 2317..2772 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis" CDS complement(2868..3680) /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 3802..4390 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature complement(4576..4718) /label=bom /note="basis of mobility region from pBR322" CDS complement(4823..5011) /codon_start=1 /label=rop /note="Rop protein, which maintains plasmids at low copy number" /translation="VTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA DELYRSCLARFGDDGENL" protein_bind complement(5786..5807) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." CDS complement(5823..6902) /codon_start=1 /label=lacI /note="lac repressor" /translation="VKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR ALADSLMQLARQVSRLESGQ" promoter complement(6903..6980) /label=lacI promoter promoter 7289..7307 /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" protein_bind 7308..7332 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)."
This page is informational only.